Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6865
Gene name	Tachykinin receptor 2
Gene symbol	TACR2
Synonyms (NCBI Gene)	NK2RNKNARSKRTAC2R
Chromosome	10
Chromosome location	10q22.1
Summary	This gene belongs to a family of genes that function as receptors for tachykinins. Receptor affinities are specified by variations in the 5`-end of the sequence. The receptors belonging to this family are characterized by interactions with G proteins an

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017841	hsa-miR-335-5p	Microarray	18185580
MIRT645579	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT645578	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT645576	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT645577	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT645575	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT645574	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT645573	hsa-miR-1976	HITS-CLIP	23824327
MIRT645572	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT645571	hsa-miR-4252	HITS-CLIP	23824327
MIRT645570	hsa-miR-1254	HITS-CLIP	23824327
MIRT645569	hsa-miR-3116	HITS-CLIP	23824327
MIRT645568	hsa-miR-661	HITS-CLIP	23824327
MIRT645567	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT645566	hsa-miR-7703	HITS-CLIP	23824327
MIRT569262	hsa-miR-4293	PAR-CLIP	20371350
MIRT569261	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT569260	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT569262	hsa-miR-4293	PAR-CLIP	20371350
MIRT569261	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT569260	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT645579	hsa-miR-483-3p	HITS-CLIP	23824327
MIRT645578	hsa-miR-1273g-3p	HITS-CLIP	23824327
MIRT645576	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT645577	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT645575	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT645574	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT645573	hsa-miR-1976	HITS-CLIP	23824327
MIRT645572	hsa-miR-4793-3p	HITS-CLIP	23824327
MIRT645571	hsa-miR-4252	HITS-CLIP	23824327
MIRT645570	hsa-miR-1254	HITS-CLIP	23824327
MIRT645569	hsa-miR-3116	HITS-CLIP	23824327
MIRT645568	hsa-miR-661	HITS-CLIP	23824327
MIRT645567	hsa-miR-1227-3p	HITS-CLIP	23824327
MIRT645566	hsa-miR-7703	HITS-CLIP	23824327
MIRT569262	hsa-miR-4293	PAR-CLIP	20371350
MIRT569261	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT569260	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT569262	hsa-miR-4293	PAR-CLIP	20371350
MIRT569261	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT569260	hsa-miR-6823-5p	PAR-CLIP	20371350
MIRT1408517	hsa-miR-1260	CLIP-seq
MIRT1408518	hsa-miR-1260b	CLIP-seq
MIRT1408519	hsa-miR-1273f	CLIP-seq
MIRT1408520	hsa-miR-1292	CLIP-seq
MIRT1408521	hsa-miR-1293	CLIP-seq
MIRT1408522	hsa-miR-141	CLIP-seq
MIRT1408523	hsa-miR-142-5p	CLIP-seq
MIRT1408524	hsa-miR-143	CLIP-seq
MIRT1408525	hsa-miR-150	CLIP-seq
MIRT1408526	hsa-miR-186	CLIP-seq
MIRT1408527	hsa-miR-188-3p	CLIP-seq
MIRT1408528	hsa-miR-200a	CLIP-seq
MIRT1408529	hsa-miR-24	CLIP-seq
MIRT1408530	hsa-miR-3122	CLIP-seq
MIRT1408531	hsa-miR-3133	CLIP-seq
MIRT1408532	hsa-miR-3155	CLIP-seq
MIRT1408533	hsa-miR-3155b	CLIP-seq
MIRT1408534	hsa-miR-3156-3p	CLIP-seq
MIRT1408535	hsa-miR-3162-3p	CLIP-seq
MIRT1408536	hsa-miR-3202	CLIP-seq
MIRT1408537	hsa-miR-340	CLIP-seq
MIRT1408538	hsa-miR-3909	CLIP-seq
MIRT1408539	hsa-miR-3910	CLIP-seq
MIRT1408540	hsa-miR-3913-5p	CLIP-seq
MIRT1408541	hsa-miR-3921	CLIP-seq
MIRT1408542	hsa-miR-4251	CLIP-seq
MIRT1408543	hsa-miR-4284	CLIP-seq
MIRT1408544	hsa-miR-4299	CLIP-seq
MIRT1408545	hsa-miR-4329	CLIP-seq
MIRT1408546	hsa-miR-4456	CLIP-seq
MIRT1408547	hsa-miR-4471	CLIP-seq
MIRT1408548	hsa-miR-4483	CLIP-seq
MIRT1408549	hsa-miR-4493	CLIP-seq
MIRT1408550	hsa-miR-4533	CLIP-seq
MIRT1408551	hsa-miR-4653-5p	CLIP-seq
MIRT1408552	hsa-miR-4708-5p	CLIP-seq
MIRT1408553	hsa-miR-4770	CLIP-seq
MIRT1408554	hsa-miR-484	CLIP-seq
MIRT1408555	hsa-miR-548q	CLIP-seq
MIRT1408556	hsa-miR-554	CLIP-seq
MIRT1408557	hsa-miR-583	CLIP-seq
MIRT2344965	hsa-miR-3125	CLIP-seq
MIRT2344966	hsa-miR-3916	CLIP-seq
MIRT2344967	hsa-miR-4311	CLIP-seq
MIRT2344968	hsa-miR-4710	CLIP-seq
MIRT2344969	hsa-miR-4717-3p	CLIP-seq
MIRT2344970	hsa-miR-4792	CLIP-seq
MIRT1408523	hsa-miR-142-5p	CLIP-seq
MIRT1408526	hsa-miR-186	CLIP-seq
MIRT1408531	hsa-miR-3133	CLIP-seq
MIRT1408537	hsa-miR-340	CLIP-seq
MIRT2461057	hsa-miR-3672	CLIP-seq
MIRT1408557	hsa-miR-583	CLIP-seq

Show/Hide all (33)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004995	Function	Tachykinin receptor activity	IEA
GO:0004995	Function	Tachykinin receptor activity	TAS	8307161
GO:0005515	Function	Protein binding	IPI	12716968, 23597562
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	2173708
GO:0006936	Process	Muscle contraction	TAS	2173708
GO:0006940	Process	Regulation of smooth muscle contraction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007217	Process	Tachykinin receptor signaling pathway	TAS	8307161
GO:0014057	Process	Positive regulation of acetylcholine secretion, neurotransmission	IEA
GO:0014827	Process	Intestine smooth muscle contraction	IEA
GO:0016020	Component	Membrane	IEA
GO:0016497	Function	Substance K receptor activity	IBA
GO:0016497	Function	Substance K receptor activity	IEA
GO:0033685	Process	Negative regulation of luteinizing hormone secretion	IEA
GO:0035106	Process	Operant conditioning	IEA
GO:0036126	Component	Sperm flagellum	IDA	17437961
GO:0043117	Process	Positive regulation of vascular permeability	IEA
GO:0043270	Process	Positive regulation of monoatomic ion transport	IEA
GO:0045987	Process	Positive regulation of smooth muscle contraction	TAS	10862829
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0061827	Component	Sperm head	IDA	17437961
GO:0070459	Process	Prolactin secretion	IEA
GO:0070472	Process	Regulation of uterine smooth muscle contraction	IEA
GO:0070474	Process	Positive regulation of uterine smooth muscle contraction	IEA
GO:0097225	Component	Sperm midpiece	IBA
GO:0097225	Component	Sperm midpiece	IDA	17437961
GO:1902093	Process	Positive regulation of flagellated sperm motility	IBA
GO:1902093	Process	Positive regulation of flagellated sperm motility	IMP	17437961

MIM	HGNC	e!Ensembl
162321	11527	ENSG00000075073

P21452

Protein name

Substance-K receptor (SKR) (NK-2 receptor) (NK-2R) (Neurokinin A receptor) (Tachykinin receptor 2)

Protein function

This is a receptor for the tachykinin neuropeptide substance K (neurokinin A). It is associated with G proteins that activate a phosphatidylinositol-calcium second messenger system. The rank order of affinity of this receptor to tachykinins is:

PDB

7XWO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	50 → 307	7 transmembrane receptor (rhodopsin family)	Family

Sequence

MGTCDIVTEANISSGPESNTTGITAFSMPSWQLALWATAYLALVLVAVTGNAIVIWIILA
HRRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPSTKAVIAGIWLVALALASPQCFYSTVTMDQGATK
CVVAWPEDSGGKTLLLYHLVVIALIYFLPLAVMFVAYSVIGLTLWRRAVPGHQAHGANLR
HLQAMKKFVKTMVLVVLTFAICWLPYHLYFILGSFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTKEDKLELTPTTSLSTRVNRCHTKETLFMA
GDTAPSEATSGEAGRPQDGSGLWFGYGLLAPTKTHVEI

Sequence length

398

Interactions

View interactions

	KEGG		Reactome
	Calcium signaling pathway Neuroactive ligand-receptor interaction		Tachykinin receptors bind tachykinins G alpha (q) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (27)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	BEFREE	16961715, 20175803, 22105467		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma, Occupational	Asthma	BEFREE	16961715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30223097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Diseases	Bronchial Diseases	CTD_human_DG	15774269		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	30223097		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17532769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	11073811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22733436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	16893949, 35509099	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	11073811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	11073811	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	20008142	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30711443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diverticular Diseases	Diverticular Diseases	BEFREE	17959748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	27456549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibromuscular Dysplasia	Fibromuscular Dysplasia	BEFREE	31810782		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRONTOMETAPHYSEAL DYSPLASIA 1	Frontometaphyseal Dysplasia	BEFREE	31810782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	11073811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	11073811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	27456549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30711443		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Facioscapulohumeral	Facioscapulohumeral Muscular Dystrophy	BEFREE	31810782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	17968170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	34446027	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16154193		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	11073811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	27456549		★★★★★ ★☆☆☆☆ Found in Text Mining only

TACR2 (tachykinin receptor 2)