Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6845
Gene name	Vesicle associated membrane protein 7
Gene symbol	VAMP7
Synonyms (NCBI Gene)	SYBL1TI-VAMPTIVAMPVAMP-7
Chromosome	X\|Y
Chromosome location	Xq28 and Yq12
Summary	This gene encodes a transmembrane protein that is a member of the soluble N-ethylmaleimide-sensitive factor attachment protein receptor (SNARE) family. The encoded protein localizes to late endosomes and lysosomes and is involved in the fusion of transpor

229

Show/Hide all (229)

miRTarBase ID	miRNA	Experiments	Reference
MIRT024077	hsa-miR-1-3p	Proteomics	18668040
MIRT030255	hsa-miR-26b-5p	Microarray	19088304
MIRT048872	hsa-miR-93-5p	CLASH	23622248
MIRT1481882	hsa-miR-1248	CLIP-seq
MIRT1481883	hsa-miR-1271	CLIP-seq
MIRT1481884	hsa-miR-1273g	CLIP-seq
MIRT1481885	hsa-miR-1298	CLIP-seq
MIRT1481886	hsa-miR-182	CLIP-seq
MIRT1481887	hsa-miR-204	CLIP-seq
MIRT1481888	hsa-miR-2054	CLIP-seq
MIRT1481889	hsa-miR-211	CLIP-seq
MIRT1481890	hsa-miR-31	CLIP-seq
MIRT1481891	hsa-miR-3125	CLIP-seq
MIRT1481892	hsa-miR-3146	CLIP-seq
MIRT739964	hsa-miR-331-5p	CLIP-seq
MIRT1481893	hsa-miR-3662	CLIP-seq
MIRT1481894	hsa-miR-380	CLIP-seq
MIRT1481895	hsa-miR-3916	CLIP-seq
MIRT1481896	hsa-miR-4257	CLIP-seq
MIRT1481897	hsa-miR-4318	CLIP-seq
MIRT1481898	hsa-miR-4461	CLIP-seq
MIRT1481899	hsa-miR-4755-5p	CLIP-seq
MIRT1481900	hsa-miR-539	CLIP-seq
MIRT1481901	hsa-miR-580	CLIP-seq
MIRT1481902	hsa-miR-621	CLIP-seq
MIRT1481903	hsa-miR-623	CLIP-seq
MIRT739963	hsa-miR-640	CLIP-seq
MIRT1481904	hsa-miR-664	CLIP-seq
MIRT1481905	hsa-miR-9	CLIP-seq
MIRT1481906	hsa-miR-96	CLIP-seq
MIRT1481907	hsa-miR-2355-5p	CLIP-seq
MIRT1481908	hsa-miR-4698	CLIP-seq
MIRT1481909	hsa-miR-548p	CLIP-seq
MIRT1481882	hsa-miR-1248	CLIP-seq
MIRT2144947	hsa-miR-1252	CLIP-seq
MIRT1481884	hsa-miR-1273g	CLIP-seq
MIRT1481887	hsa-miR-204	CLIP-seq
MIRT1481889	hsa-miR-211	CLIP-seq
MIRT2144948	hsa-miR-3065-3p	CLIP-seq
MIRT2144949	hsa-miR-3154	CLIP-seq
MIRT2144950	hsa-miR-3161	CLIP-seq
MIRT1481897	hsa-miR-4318	CLIP-seq
MIRT1481899	hsa-miR-4755-5p	CLIP-seq
MIRT1481903	hsa-miR-623	CLIP-seq
MIRT1481905	hsa-miR-9	CLIP-seq
MIRT2365403	hsa-miR-3922-5p	CLIP-seq
MIRT2365404	hsa-miR-200b	CLIP-seq
MIRT2365405	hsa-miR-200c	CLIP-seq
MIRT2365406	hsa-miR-429	CLIP-seq
MIRT1481882	hsa-miR-1248	CLIP-seq
MIRT2659155	hsa-miR-1179	CLIP-seq
MIRT2659156	hsa-miR-1231	CLIP-seq
MIRT2144947	hsa-miR-1252	CLIP-seq
MIRT2659157	hsa-miR-1273	CLIP-seq
MIRT2659158	hsa-miR-1297	CLIP-seq
MIRT2659159	hsa-miR-1323	CLIP-seq
MIRT2659160	hsa-miR-136	CLIP-seq
MIRT2659161	hsa-miR-147	CLIP-seq
MIRT2659162	hsa-miR-15a	CLIP-seq
MIRT2659163	hsa-miR-15b	CLIP-seq
MIRT2659164	hsa-miR-16	CLIP-seq
MIRT2659165	hsa-miR-186	CLIP-seq
MIRT2659166	hsa-miR-195	CLIP-seq
MIRT2659167	hsa-miR-2052	CLIP-seq
MIRT2659168	hsa-miR-2053	CLIP-seq
MIRT2659169	hsa-miR-2113	CLIP-seq
MIRT2659170	hsa-miR-218	CLIP-seq
MIRT1481907	hsa-miR-2355-5p	CLIP-seq
MIRT2659171	hsa-miR-2682	CLIP-seq
MIRT2659172	hsa-miR-26a	CLIP-seq
MIRT2659173	hsa-miR-26b	CLIP-seq
MIRT2659174	hsa-miR-2861	CLIP-seq
MIRT2659175	hsa-miR-29a	CLIP-seq
MIRT2659176	hsa-miR-29b	CLIP-seq
MIRT2659177	hsa-miR-29c	CLIP-seq
MIRT2144948	hsa-miR-3065-3p	CLIP-seq
MIRT2659178	hsa-miR-3117-5p	CLIP-seq
MIRT2659179	hsa-miR-3121-3p	CLIP-seq
MIRT2659180	hsa-miR-3133	CLIP-seq
MIRT1481892	hsa-miR-3146	CLIP-seq
MIRT2659181	hsa-miR-3148	CLIP-seq
MIRT2659182	hsa-miR-3149	CLIP-seq
MIRT2144949	hsa-miR-3154	CLIP-seq
MIRT2659183	hsa-miR-3156-5p	CLIP-seq
MIRT2144950	hsa-miR-3161	CLIP-seq
MIRT2659184	hsa-miR-323b-5p	CLIP-seq
MIRT739964	hsa-miR-331-5p	CLIP-seq
MIRT2659185	hsa-miR-3591-5p	CLIP-seq
MIRT2659186	hsa-miR-3646	CLIP-seq
MIRT2659187	hsa-miR-3653	CLIP-seq
MIRT2659188	hsa-miR-3658	CLIP-seq
MIRT2659189	hsa-miR-3670	CLIP-seq
MIRT2659190	hsa-miR-3671	CLIP-seq
MIRT2659191	hsa-miR-3935	CLIP-seq
MIRT2659192	hsa-miR-411	CLIP-seq
MIRT2659193	hsa-miR-424	CLIP-seq
MIRT2659194	hsa-miR-4255	CLIP-seq
MIRT2659195	hsa-miR-4288	CLIP-seq
MIRT2659196	hsa-miR-4303	CLIP-seq
MIRT2659197	hsa-miR-4418	CLIP-seq
MIRT2659198	hsa-miR-4422	CLIP-seq
MIRT2659199	hsa-miR-4432	CLIP-seq
MIRT2659200	hsa-miR-4463	CLIP-seq
MIRT2659201	hsa-miR-4465	CLIP-seq
MIRT2659202	hsa-miR-4477b	CLIP-seq
MIRT2659203	hsa-miR-449c	CLIP-seq
MIRT2659204	hsa-miR-452	CLIP-seq
MIRT2659205	hsa-miR-4635	CLIP-seq
MIRT2659206	hsa-miR-4676-3p	CLIP-seq
MIRT2659207	hsa-miR-4694-3p	CLIP-seq
MIRT2659208	hsa-miR-4704-5p	CLIP-seq
MIRT2659209	hsa-miR-4719	CLIP-seq
MIRT2659210	hsa-miR-4753-3p	CLIP-seq
MIRT2659211	hsa-miR-4760-3p	CLIP-seq
MIRT2659212	hsa-miR-4789-5p	CLIP-seq
MIRT2659213	hsa-miR-4796-5p	CLIP-seq
MIRT2659214	hsa-miR-485-3p	CLIP-seq
MIRT2659215	hsa-miR-495	CLIP-seq
MIRT2659216	hsa-miR-497	CLIP-seq
MIRT2659217	hsa-miR-498	CLIP-seq
MIRT2659218	hsa-miR-499-5p	CLIP-seq
MIRT2659219	hsa-miR-509-3-5p	CLIP-seq
MIRT2659220	hsa-miR-509-5p	CLIP-seq
MIRT2659221	hsa-miR-513b	CLIP-seq
MIRT2659222	hsa-miR-515-5p	CLIP-seq
MIRT2659223	hsa-miR-520d-5p	CLIP-seq
MIRT2659224	hsa-miR-522	CLIP-seq
MIRT2659225	hsa-miR-524-5p	CLIP-seq
MIRT2659226	hsa-miR-548ac	CLIP-seq
MIRT2659227	hsa-miR-548ae	CLIP-seq
MIRT2659228	hsa-miR-548aj	CLIP-seq
MIRT2659229	hsa-miR-548am	CLIP-seq
MIRT2659230	hsa-miR-548d-3p	CLIP-seq
MIRT2659231	hsa-miR-548g	CLIP-seq
MIRT2659232	hsa-miR-548o	CLIP-seq
MIRT2659233	hsa-miR-548x	CLIP-seq
MIRT2659234	hsa-miR-548z	CLIP-seq
MIRT2659235	hsa-miR-561	CLIP-seq
MIRT2659236	hsa-miR-577	CLIP-seq
MIRT2659237	hsa-miR-593	CLIP-seq
MIRT2659238	hsa-miR-599	CLIP-seq
MIRT2659239	hsa-miR-632	CLIP-seq
MIRT2659240	hsa-miR-636	CLIP-seq
MIRT739963	hsa-miR-640	CLIP-seq
MIRT2659241	hsa-miR-875-3p	CLIP-seq
MIRT2659242	hsa-miR-940	CLIP-seq
MIRT2659156	hsa-miR-1231	CLIP-seq
MIRT2144947	hsa-miR-1252	CLIP-seq
MIRT2659157	hsa-miR-1273	CLIP-seq
MIRT2659158	hsa-miR-1297	CLIP-seq
MIRT2659159	hsa-miR-1323	CLIP-seq
MIRT2659160	hsa-miR-136	CLIP-seq
MIRT2659161	hsa-miR-147	CLIP-seq
MIRT2659162	hsa-miR-15a	CLIP-seq
MIRT2659163	hsa-miR-15b	CLIP-seq
MIRT2659164	hsa-miR-16	CLIP-seq
MIRT2659165	hsa-miR-186	CLIP-seq
MIRT2659166	hsa-miR-195	CLIP-seq
MIRT2659167	hsa-miR-2052	CLIP-seq
MIRT2659168	hsa-miR-2053	CLIP-seq
MIRT2659169	hsa-miR-2113	CLIP-seq
MIRT2659170	hsa-miR-218	CLIP-seq
MIRT1481907	hsa-miR-2355-5p	CLIP-seq
MIRT2659172	hsa-miR-26a	CLIP-seq
MIRT2659173	hsa-miR-26b	CLIP-seq
MIRT2659174	hsa-miR-2861	CLIP-seq
MIRT2659175	hsa-miR-29a	CLIP-seq
MIRT2659176	hsa-miR-29b	CLIP-seq
MIRT2659177	hsa-miR-29c	CLIP-seq
MIRT2144948	hsa-miR-3065-3p	CLIP-seq
MIRT2659178	hsa-miR-3117-5p	CLIP-seq
MIRT2659180	hsa-miR-3133	CLIP-seq
MIRT1481892	hsa-miR-3146	CLIP-seq
MIRT2659181	hsa-miR-3148	CLIP-seq
MIRT2659182	hsa-miR-3149	CLIP-seq
MIRT2144949	hsa-miR-3154	CLIP-seq
MIRT2659183	hsa-miR-3156-5p	CLIP-seq
MIRT2144950	hsa-miR-3161	CLIP-seq
MIRT2659184	hsa-miR-323b-5p	CLIP-seq
MIRT2659185	hsa-miR-3591-5p	CLIP-seq
MIRT2659186	hsa-miR-3646	CLIP-seq
MIRT2659189	hsa-miR-3670	CLIP-seq
MIRT2659190	hsa-miR-3671	CLIP-seq
MIRT2659191	hsa-miR-3935	CLIP-seq
MIRT2659192	hsa-miR-411	CLIP-seq
MIRT2659193	hsa-miR-424	CLIP-seq
MIRT2659194	hsa-miR-4255	CLIP-seq
MIRT2659195	hsa-miR-4288	CLIP-seq
MIRT2659196	hsa-miR-4303	CLIP-seq
MIRT2659197	hsa-miR-4418	CLIP-seq
MIRT2659199	hsa-miR-4432	CLIP-seq
MIRT2659200	hsa-miR-4463	CLIP-seq
MIRT2659201	hsa-miR-4465	CLIP-seq
MIRT2659204	hsa-miR-452	CLIP-seq
MIRT2659205	hsa-miR-4635	CLIP-seq
MIRT2659206	hsa-miR-4676-3p	CLIP-seq
MIRT2659207	hsa-miR-4694-3p	CLIP-seq
MIRT2659208	hsa-miR-4704-5p	CLIP-seq
MIRT2659209	hsa-miR-4719	CLIP-seq
MIRT2659210	hsa-miR-4753-3p	CLIP-seq
MIRT2659211	hsa-miR-4760-3p	CLIP-seq
MIRT2659213	hsa-miR-4796-5p	CLIP-seq
MIRT2659214	hsa-miR-485-3p	CLIP-seq
MIRT2659215	hsa-miR-495	CLIP-seq
MIRT2659216	hsa-miR-497	CLIP-seq
MIRT2659217	hsa-miR-498	CLIP-seq
MIRT2659218	hsa-miR-499-5p	CLIP-seq
MIRT2659219	hsa-miR-509-3-5p	CLIP-seq
MIRT2659220	hsa-miR-509-5p	CLIP-seq
MIRT2659221	hsa-miR-513b	CLIP-seq
MIRT2659222	hsa-miR-515-5p	CLIP-seq
MIRT2659223	hsa-miR-520d-5p	CLIP-seq
MIRT2659224	hsa-miR-522	CLIP-seq
MIRT2659225	hsa-miR-524-5p	CLIP-seq
MIRT2659226	hsa-miR-548ac	CLIP-seq
MIRT2659227	hsa-miR-548ae	CLIP-seq
MIRT2659228	hsa-miR-548aj	CLIP-seq
MIRT2659229	hsa-miR-548am	CLIP-seq
MIRT2659230	hsa-miR-548d-3p	CLIP-seq
MIRT2659231	hsa-miR-548g	CLIP-seq
MIRT2659232	hsa-miR-548o	CLIP-seq
MIRT2659233	hsa-miR-548x	CLIP-seq
MIRT2659234	hsa-miR-548z	CLIP-seq
MIRT2659235	hsa-miR-561	CLIP-seq
MIRT2659236	hsa-miR-577	CLIP-seq
MIRT2659237	hsa-miR-593	CLIP-seq
MIRT2659238	hsa-miR-599	CLIP-seq
MIRT2659239	hsa-miR-632	CLIP-seq
MIRT2659241	hsa-miR-875-3p	CLIP-seq

Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000149	Function	SNARE binding	IBA
GO:0005484	Function	SNAP receptor activity	IBA
GO:0005515	Function	Protein binding	IPI	16354670, 18775314, 26359495, 33845483, 34706264
GO:0005737	Component	Cytoplasm	IDA	18253931
GO:0005764	Component	Lysosome	IEA
GO:0005765	Component	Lysosomal membrane	HDA	17897319
GO:0005765	Component	Lysosomal membrane	IEA
GO:0005765	Component	Lysosomal membrane	ISS	10459012
GO:0005765	Component	Lysosomal membrane	TAS
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	ISS	16495485
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	19745841
GO:0005886	Component	Plasma membrane	IDA	18253931
GO:0005886	Component	Plasma membrane	TAS
GO:0006887	Process	Exocytosis	IBA
GO:0006887	Process	Exocytosis	IEA
GO:0006888	Process	Endoplasmic reticulum to Golgi vesicle-mediated transport	ISS	16495485
GO:0006906	Process	Vesicle fusion	IBA
GO:0006906	Process	Vesicle fusion	IDA	10888671
GO:0006906	Process	Vesicle fusion	IEA
GO:0006911	Process	Phagocytosis, engulfment	ISS	15133481
GO:0008333	Process	Endosome to lysosome transport	IBA
GO:0008333	Process	Endosome to lysosome transport	IDA	10888671
GO:0012505	Component	Endomembrane system	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IDA	16677249
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IDA	10888671
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0017156	Process	Calcium-ion regulated exocytosis	ISS	14993220
GO:0030027	Component	Lamellipodium	IDA	22589474
GO:0030141	Component	Secretory granule	IDA	18042464
GO:0030658	Component	Transport vesicle membrane	IEA
GO:0030667	Component	Secretory granule membrane	IDA	16677249
GO:0030669	Component	Clathrin-coated endocytic vesicle membrane	TAS
GO:0030670	Component	Phagocytic vesicle membrane	IEA
GO:0031091	Component	Platelet alpha granule	IDA	22589474
GO:0031143	Component	Pseudopodium	IDA	22589474
GO:0031201	Component	SNARE complex	IBA
GO:0031201	Component	SNARE complex	IDA	18253931, 24550300
GO:0031201	Component	SNARE complex	ISS	15133481
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031902	Component	Late endosome membrane	IEA
GO:0031902	Component	Late endosome membrane	ISS	10459012
GO:0035577	Component	Azurophil granule membrane	IDA	16677249
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043308	Process	Eosinophil degranulation	IMP	16677249
GO:0043308	Process	Eosinophil degranulation	ISS	14993220
GO:0043312	Process	Neutrophil degranulation	IMP	16677249
GO:0043312	Process	Neutrophil degranulation	ISS	14993220
GO:0043320	Process	Natural killer cell degranulation	IMP	18042464
GO:0045202	Component	Synapse	IEA
GO:0045335	Component	Phagocytic vesicle	ISS	15470500
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0097352	Process	Autophagosome maturation	IMP	23217709
GO:0120025	Component	Plasma membrane bounded cell projection	IEA
GO:1903595	Process	Positive regulation of histamine secretion by mast cell	IMP	18253931

MIM	HGNC	e!Ensembl
300053	11486	ENSG00000124333

P51809

Protein name

Vesicle-associated membrane protein 7 (VAMP-7) (Synaptobrevin-like protein 1) (Tetanus-insensitive VAMP) (Ti-VAMP)

Protein function

Involved in the targeting and/or fusion of transport vesicles to their target membrane during transport of proteins from the early endosome to the lysosome. Required for heterotypic fusion of late endosomes with lysosomes and homotypic lysosomal

PDB

2DMW

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13774	Longin	29 → 108	Regulated-SNARE-like domain	Domain
PF00957	Synaptobrevin	122 → 210	Synaptobrevin	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in all tissues tested.

Sequence

MAILFAVVARGTTILAKHAWCGGNFLEVTEQILAKIPSENNKLTYSHGNYLFHYICQDRI
VYLCITDDDFERSRAFNFLNEIKKRFQTTYGSRAQTALPYAMNSEFSSVLAAQLKHHSEN
KGLDKVMETQAQVDELKGIMVRNIDLVAQRGERLELLIDKTENLVDSSVTFKTTSRNLAR
AMCMKNLKLTIIIIIVSIVFIYIIVSPLCGGFTWPSCVKK

Sequence length

220

Interactions

View interactions

	KEGG		Reactome
	SNARE interactions in vesicular transport		trans-Golgi Network Vesicle Budding Lysosome Vesicle Biogenesis Golgi Associated Vesicle Biogenesis Cargo recognition for clathrin-mediated endocytosis Clathrin-mediated endocytosis Interleukin-12 signaling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VAMP7-related disorder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (53)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
46,XY partial gonadal dysgenesis	46, XY partial gonadal dysgenesis	ORPHANET_DG	24880616		★★★★★ ★☆☆☆☆ Found in Text Mining only
46,XY partial gonadal dysgenesis	46, XY partial gonadal dysgenesis	Orphanet			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ambiguous Genitalia	Ambiguous Genitalia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	33092533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	11840509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	10898908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18571410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18571410	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	10898908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34088337	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	22365286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33787596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31029038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	32831056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cold urticaria	Cold urticaria	BEFREE	26843440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22188132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis	Gonadal Dysgenesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gynecomastia	Gynecomastia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophy of clitoris	Hypertrophy Of Clitoris	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoplasia of vagina	Hypoplasia Of Vagina	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	11840509		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	11840509		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	11840509		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	11840509		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	11840509		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	11840509		★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	11840509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31029038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18571410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23358896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31029038		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvillus inclusion disease	Microvillus inclusion disease	Pubtator	26553929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	LHGDN	11840509		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian gonadoblastoma	Ovarian gonadoblastoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Penis agenesis	Penis Agenesis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary hypogonadism	Hypogonadism	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary physiologic amenorrhea	Physiologic Amenorrhea	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett Syndrome	BEFREE	12075494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12782970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	39331939	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Specific Granule Deficiency	Specific granule deficiency	Pubtator	31447853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	23358896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35082283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Streak ovary	Streak ovary	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular gonadoblastoma	Testicular gonadoblastoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular regression syndrome	Testicular regression syndrome	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	27997249		★★★★★ ★☆☆☆☆ Found in Text Mining only

VAMP7 (vesicle associated membrane protein 7)