Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	683
Gene name	Bone marrow stromal cell antigen 1
Gene symbol	BST1
Synonyms (NCBI Gene)	CD157cADPR2
Chromosome	4
Chromosome location	4p15.32
Summary	Bone marrow stromal cell antigen-1 is a stromal cell line-derived glycosylphosphatidylinositol-anchored molecule that facilitates pre-B-cell growth. The deduced amino acid sequence exhibits 33% similarity with CD38. BST1 expression is enhanced in bone mar

Show/Hide all (3)

miRTarBase ID	miRNA	Experiments	Reference
MIRT738077	hsa-miR-2276	HITS-CLIP	33718276
MIRT738081	hsa-miR-579	HITS-CLIP	33718276
MIRT826169	hsa-miR-203	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
NFKB1	Unknown	9030974

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001931	Component	Uropod	IDA	15328157
GO:0001952	Process	Regulation of cell-matrix adhesion	IDA	15328157
GO:0002691	Process	Regulation of cellular extravasation	TAS	23576305
GO:0005576	Component	Extracellular region	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8202488
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006959	Process	Humoral immune response	IC	8202488
GO:0007165	Process	Signal transduction	TAS	23576305
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	8202488
GO:0016020	Component	Membrane	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016798	Function	Hydrolase activity, acting on glycosyl bonds	IEA
GO:0016849	Function	Phosphorus-oxygen lyase activity	IBA
GO:0030890	Process	Positive regulation of B cell proliferation	IBA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	15328157
GO:0035579	Component	Specific granule membrane	TAS
GO:0050727	Process	Regulation of inflammatory response	IDA	15328157
GO:0050848	Process	Regulation of calcium-mediated signaling	IMP	15328157
GO:0050848	Process	Regulation of calcium-mediated signaling	TAS	23576305
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IDA	7805847, 11866528
GO:0061809	Function	NAD+ nucleosidase activity, cyclic ADP-ribose generating	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0090022	Process	Regulation of neutrophil chemotaxis	IDA	15328157
GO:0090322	Process	Regulation of superoxide metabolic process	TAS	23576305
GO:0098552	Component	Side of membrane	IEA
GO:2001044	Process	Regulation of integrin-mediated signaling pathway	TAS	23576305

MIM	HGNC	e!Ensembl
600387	1118	ENSG00000109743

Q10588

Protein name

ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 2 (EC 3.2.2.6) (ADP-ribosyl cyclase 2) (Bone marrow stromal cell antigen 1) (BST-1) (Cyclic ADP-ribose hydrolase 2) (cADPR hydrolase 2) (CD antigen CD157)

Protein function

Catalyzes both the synthesis of cyclic ADP-beta-D-ribose (cADPR) from NAD(+), and its hydrolysis to ADP-D-ribose (ADPR) (PubMed:7805847). Cyclic ADPR is known to serve as an endogenous second messenger that elicits calcium release from intracell

PDB

1ISF , 1ISG , 1ISH , 1ISI , 1ISJ , 1ISM

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02267	Rib_hydrolayse	40 → 280	ADP-ribosyl cyclase	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in various tissues including placenta, lung, liver and kidney. {ECO:0000269|PubMed:8202488}.

Sequence

MAAQGCAASRLLQLLLQLLLLLLLLAAGGARARWRGEGTSAHLRDIFLGRCAEYRALLSP
EQRNKNCTAIWEAFKVALDKDPCSVLPSDYDLFINLSRHSIPRDKSLFWENSHLLVNSFA
DNTRRFMPLSDVLYGRVADFLSWCRQKNDSGLDYQSCPTSEDCENNPVDSFWKRASIQYS
KDSSGVIHVMLNGSEPTGAYPIKGFFADYEIPNLQKEKITRIEIWVMHEIGGPNVESCGE
GSMKVLEKRLKDMGFQYSCINDYRPVKLLQCVDHSTHPDCALKSAAAATQRKAPSLYTEQ
RAGLIIPLFLVLASRTQL

Sequence length

318

Interactions

View interactions

	KEGG		Reactome
	Nicotinate and nicotinamide metabolism Metabolic pathways Salivary secretion Pancreatic secretion		Post-translational modification: synthesis of GPI-anchored proteins Nicotinate metabolism Neutrophil degranulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LEWY BODY DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

BST1 (bone marrow stromal cell antigen 1)