SULT2A1 (sulfotransferase family 2A member 1)

Gene

• Entrez ID: 6822
• Gene name: Sulfotransferase family 2A member 1
• Gene symbol: SULT2A1
• Synonyms (NCBI Gene): DHEA-ST, DHEA-ST8, DHEAS, HST, ST2, ST2A1, ST2A3, STD, SULT2A3, hSTa
• Chromosome: 19
• Chromosome location: 19q13.33
• Summary: This gene encodes a member of the sulfotransferase family. Sulfotransferases aid in the metabolism of drugs and endogenous compounds by converting these substances into more hydrophilic water-soluble sulfate conjugates that can be easily excreted. This pr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017405	hsa-miR-335-5p	Microarray	18185580
MIRT030437	hsa-miR-24-3p	Microarray	19748357
MIRT736032	hsa-miR-486-5p	Luciferase reporter assay, Western blotting, qRT-PCR	31445882
MIRT1402899	hsa-miR-1183	CLIP-seq
MIRT1402900	hsa-miR-1193	CLIP-seq
MIRT1402901	hsa-miR-1200	CLIP-seq
MIRT1402902	hsa-miR-1208	CLIP-seq
MIRT1402903	hsa-miR-122	CLIP-seq
MIRT1402904	hsa-miR-139-3p	CLIP-seq
MIRT1402905	hsa-miR-1976	CLIP-seq
MIRT1402906	hsa-miR-2392	CLIP-seq
MIRT1402907	hsa-miR-3135b	CLIP-seq
MIRT1402908	hsa-miR-3137	CLIP-seq
MIRT1402909	hsa-miR-3152-3p	CLIP-seq
MIRT1402910	hsa-miR-3170	CLIP-seq
MIRT1402911	hsa-miR-3652	CLIP-seq
MIRT1402912	hsa-miR-3672	CLIP-seq
MIRT1402913	hsa-miR-4264	CLIP-seq
MIRT1402914	hsa-miR-4324	CLIP-seq
MIRT1402915	hsa-miR-4430	CLIP-seq
MIRT1402916	hsa-miR-4438	CLIP-seq
MIRT1402917	hsa-miR-4454	CLIP-seq
MIRT1402918	hsa-miR-4473	CLIP-seq
MIRT1402919	hsa-miR-4634	CLIP-seq
MIRT1402920	hsa-miR-4662a-5p	CLIP-seq
MIRT1402921	hsa-miR-4676-5p	CLIP-seq
MIRT1402922	hsa-miR-4682	CLIP-seq
MIRT1402923	hsa-miR-4731-5p	CLIP-seq
MIRT1402924	hsa-miR-4797-3p	CLIP-seq
MIRT1402925	hsa-miR-5095	CLIP-seq
MIRT1402926	hsa-miR-5096	CLIP-seq
MIRT1402927	hsa-miR-512-3p	CLIP-seq
MIRT1402928	hsa-miR-520f	CLIP-seq
MIRT1402929	hsa-miR-544b	CLIP-seq
MIRT1402930	hsa-miR-575	CLIP-seq
MIRT1402931	hsa-miR-622	CLIP-seq
MIRT1402932	hsa-miR-668	CLIP-seq
MIRT1402933	hsa-miR-720	CLIP-seq
MIRT1402901	hsa-miR-1200	CLIP-seq
MIRT2120784	hsa-miR-129-5p	CLIP-seq
MIRT2120785	hsa-miR-4279	CLIP-seq
MIRT1402914	hsa-miR-4324	CLIP-seq
MIRT1402919	hsa-miR-4634	CLIP-seq
MIRT1402922	hsa-miR-4682	CLIP-seq
MIRT2120786	hsa-miR-4735-5p	CLIP-seq
MIRT2120787	hsa-miR-4740-3p	CLIP-seq
MIRT2120788	hsa-miR-4775	CLIP-seq
MIRT2120789	hsa-miR-4777-3p	CLIP-seq
MIRT1402929	hsa-miR-544b	CLIP-seq
MIRT2120790	hsa-miR-590-3p	CLIP-seq
MIRT1402900	hsa-miR-1193	CLIP-seq
MIRT1402903	hsa-miR-122	CLIP-seq
MIRT1402905	hsa-miR-1976	CLIP-seq
MIRT1402906	hsa-miR-2392	CLIP-seq
MIRT1402907	hsa-miR-3135b	CLIP-seq
MIRT1402911	hsa-miR-3652	CLIP-seq
MIRT1402913	hsa-miR-4264	CLIP-seq
MIRT1402915	hsa-miR-4430	CLIP-seq
MIRT1402919	hsa-miR-4634	CLIP-seq
MIRT1402924	hsa-miR-4797-3p	CLIP-seq
MIRT1402931	hsa-miR-622	CLIP-seq
MIRT1402933	hsa-miR-720	CLIP-seq
MIRT1402903	hsa-miR-122	CLIP-seq
MIRT2395426	hsa-miR-24	CLIP-seq
MIRT1402907	hsa-miR-3135b	CLIP-seq
MIRT2395427	hsa-miR-3186-5p	CLIP-seq
MIRT1402911	hsa-miR-3652	CLIP-seq
MIRT2395428	hsa-miR-4284	CLIP-seq
MIRT2395429	hsa-miR-4317	CLIP-seq
MIRT1402915	hsa-miR-4430	CLIP-seq
MIRT1402919	hsa-miR-4634	CLIP-seq
MIRT2395430	hsa-miR-767-5p	CLIP-seq
MIRT2460815	hsa-miR-296-3p	CLIP-seq
MIRT2460816	hsa-miR-3149	CLIP-seq
MIRT2460817	hsa-miR-411	CLIP-seq
MIRT2120786	hsa-miR-4735-5p	CLIP-seq
MIRT2120788	hsa-miR-4775	CLIP-seq
MIRT2120790	hsa-miR-590-3p	CLIP-seq
MIRT2460816	hsa-miR-3149	CLIP-seq
MIRT2460817	hsa-miR-411	CLIP-seq
MIRT2120786	hsa-miR-4735-5p	CLIP-seq
MIRT2120788	hsa-miR-4775	CLIP-seq
MIRT2120790	hsa-miR-590-3p	CLIP-seq
MIRT1402901	hsa-miR-1200	CLIP-seq
MIRT1402903	hsa-miR-122	CLIP-seq
MIRT2120784	hsa-miR-129-5p	CLIP-seq
MIRT2395426	hsa-miR-24	CLIP-seq
MIRT1402907	hsa-miR-3135b	CLIP-seq
MIRT2460816	hsa-miR-3149	CLIP-seq
MIRT2395427	hsa-miR-3186-5p	CLIP-seq
MIRT2636672	hsa-miR-3199	CLIP-seq
MIRT1402911	hsa-miR-3652	CLIP-seq
MIRT2460817	hsa-miR-411	CLIP-seq
MIRT2395428	hsa-miR-4284	CLIP-seq
MIRT2395429	hsa-miR-4317	CLIP-seq
MIRT1402914	hsa-miR-4324	CLIP-seq
MIRT1402915	hsa-miR-4430	CLIP-seq
MIRT1402919	hsa-miR-4634	CLIP-seq
MIRT1402922	hsa-miR-4682	CLIP-seq
MIRT2120786	hsa-miR-4735-5p	CLIP-seq
MIRT2120788	hsa-miR-4775	CLIP-seq
MIRT2636673	hsa-miR-4787-3p	CLIP-seq
MIRT2636674	hsa-miR-4794	CLIP-seq
MIRT1402929	hsa-miR-544b	CLIP-seq
MIRT2120790	hsa-miR-590-3p	CLIP-seq
MIRT2395430	hsa-miR-767-5p	CLIP-seq
MIRT1402901	hsa-miR-1200	CLIP-seq
MIRT1402903	hsa-miR-122	CLIP-seq
MIRT2120784	hsa-miR-129-5p	CLIP-seq
MIRT2395426	hsa-miR-24	CLIP-seq
MIRT1402907	hsa-miR-3135b	CLIP-seq
MIRT2460816	hsa-miR-3149	CLIP-seq
MIRT1402911	hsa-miR-3652	CLIP-seq
MIRT2460817	hsa-miR-411	CLIP-seq
MIRT2395428	hsa-miR-4284	CLIP-seq
MIRT2395429	hsa-miR-4317	CLIP-seq
MIRT1402914	hsa-miR-4324	CLIP-seq
MIRT1402915	hsa-miR-4430	CLIP-seq
MIRT1402919	hsa-miR-4634	CLIP-seq
MIRT1402922	hsa-miR-4682	CLIP-seq
MIRT2120786	hsa-miR-4735-5p	CLIP-seq
MIRT2120788	hsa-miR-4775	CLIP-seq
MIRT2636673	hsa-miR-4787-3p	CLIP-seq
MIRT2636674	hsa-miR-4794	CLIP-seq
MIRT1402929	hsa-miR-544b	CLIP-seq
MIRT2120790	hsa-miR-590-3p	CLIP-seq
MIRT2395430	hsa-miR-767-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
GATA6	Activation	15388788;19497978
MED1	Activation	19497978
PPARA	Unknown	20110263
SF1	Activation	15388788
SF1	Unknown	15878968

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004027	Function	Alcohol sulfotransferase activity	IDA	7854148, 19589875
GO:0004027	Function	Alcohol sulfotransferase activity	IEA
GO:0005515	Function	Protein binding	IPI	21988832, 25416956, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	2268288
GO:0005829	Component	Cytosol	TAS
GO:0006068	Process	Ethanol catabolic process	IDA	23207770
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006805	Process	Xenobiotic metabolic process	IDA	7854148
GO:0008146	Function	Sulfotransferase activity	IBA
GO:0008146	Function	Sulfotransferase activity	IDA	19548878, 20056724
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008202	Process	Steroid metabolic process	IDA	1588921, 23207770
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008202	Process	Steroid metabolic process	IMP	29671343
GO:0008203	Process	Cholesterol metabolic process	IDA	19589875
GO:0016042	Process	Lipid catabolic process	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030573	Process	Bile acid catabolic process	IEA
GO:0042403	Process	Thyroid hormone metabolic process	IDA	10199779
GO:0047704	Function	Bile-salt sulfotransferase activity	IDA	1588921, 2268288
GO:0047704	Function	Bile-salt sulfotransferase activity	IEA
GO:0050294	Function	Steroid sulfotransferase activity	IDA	23207770
GO:0050294	Function	Steroid sulfotransferase activity	IMP	29671343
GO:0050427	Process	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IDA	23207770
GO:0050656	Function	3'-phosphoadenosine 5'-phosphosulfate binding	IDA	10854859, 12471039
GO:0051923	Process	Sulfation	IBA
GO:0051923	Process	Sulfation	IDA	19548878
GO:0051923	Process	Sulfation	IDA	20056724, 23207770

Other IDs

• MIM: 125263
• HGNC: 11458
• e!Ensembl: ENSG00000105398

Protein

• UniProt ID: Q06520
• Protein name: Sulfotransferase 2A1 (ST2A1) (EC 2.8.2.2) (Bile salt sulfotransferase) (EC 2.8.2.14) (Dehydroepiandrosterone sulfotransferase) (DHEA-ST) (DHEA-ST8) (Hydroxysteroid Sulfotransferase) (HST) (ST2) (SULT2A3)
• Protein function: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfonation of steroids and bile acids in the liver and adrenal glands. Mediates the sulfation of a wide range of steroids and sterols, inclu
• PDB: 1EFH, 1J99, 1OV4, 2QP3, 2QP4, 3F3Y, 4IFB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00685	Sulfotransfer_1	34 → 278	Sulfotransferase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Liver, adrenal and at lower level in the kidney. Is present in human fetus in higher level in the adrenal than the liver and the kidney.
• Sequence:

  MSDDFLWFEGIAFPTMGFRSETLRKVRDEFVIRDEDVIILTYPKSGTNWLAEILCLMHSK
  GDAKWIQSVPIWERSPWVESEIGYTALSETESPRLFSSHLPIQLFPKSFFSSKAKVIYLM
  RNPRDVLVSGYFFWKNMKFIKKPKSWEEYFEWFCQGTVLYGSWFDHIHGWMPMREEKNFL
  LLSYEELKQDTGRTIEKICQFLGKTLEPEELNLILKNSSFQSMKENKMSNYSLLSVDYVV
  DKAQLLRKGVSGDWKNHFTVAQAEDFDKLFQEKMADLPRELFPWE

• Sequence length: 285

Pathways

KEGG:

Metabolism of xenobiotics by cytochrome P450
Bile secretion
Chemical carcinogenesis - DNA adducts

Reactome:

Cytosolic sulfonation of small molecules
PPARA activates gene expression

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CHOLELITHIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRAHEPATIC CHOLESTASIS OF PREGNANCY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL VASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	3030292		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28368480, 8100831		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	LHGDN	18505908		★☆☆☆☆ Found in Text Mining only
Adrenal Cortical Adenoma	Adrenocortical adenoma	BEFREE	30481155		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	28095038		★☆☆☆☆ Found in Text Mining only
Adrenal hyperplasia	Adrenal hyperplasia	BEFREE	19726039		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28095038, 30566905		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	8957092		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	30481155		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	30481155		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	30031631		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28712091	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	8957092		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	30031631		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	30029778		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	28367959		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	33024080	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	2474139		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12161011, 18592003, 2071147, 2181375, 2474139, 2677918		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	2071147, 2181375		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28634336	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	35599597	Inhibit	★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	8957092		★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	26504856	Associate	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	25798860		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	25798860	Inhibit	★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholelithiasis	Pubtator	25948711	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	17491508	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	3108211		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	3136110		★☆☆☆☆ Found in Text Mining only
Congenital adrenal hyperplasia	Congenital adrenal hyperplasia	BEFREE	19726039		★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	3531932		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29068593		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing`s Syndrome	BEFREE	30031631, 30817193		★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	8930526	Inhibit	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30557606		★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	28752602	Stimulate	★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	26453557		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20887769		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	30572523		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28382720		★☆☆☆☆ Found in Text Mining only
Genital ulcers	Genital ulcers	BEFREE	12567167		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10918389, 8957092		★☆☆☆☆ Found in Text Mining only
Hepatitis Chronic	Hepatitis	Pubtator	11228044	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperandrogenism	Hyperandrogenism	BEFREE	17336975, 30958034		★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	3531932		★☆☆☆☆ Found in Text Mining only
Kniest dysplasia	Kniest Dysplasia	BEFREE	15895462		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	2895649		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15713538, 2824415		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15713538		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	26504856	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	2824415		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12161011, 2474139		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16617014, 18450964, 20621111, 30890759, 9566751		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	21716162		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	2895649, 2953031, 3108211		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	3108211		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	22356824		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30557606		★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	19403438		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	28752602		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	29232479	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15713538, 18592003, 2177639, 2181375, 27987223, 29941676, 8957092		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	11341297, 28468030, 30727783		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	8957092		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	30029729		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	30029729		★☆☆☆☆ Found in Text Mining only
Ovarian Failure, Premature	Ovarian Failure	BEFREE	12199336, 30658614		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32590918	Associate	★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	7747543		★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	29335782		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	16580388, 17392600, 17426092, 23861462, 27933387, 28784626, 29723293, 29952411, 30727783, 30958034		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	LHGDN	17426092		★☆☆☆☆ Found in Text Mining only
PONTOCEREBELLAR HYPOPLASIA, TYPE 1B	Pontoneocerebellar hypoplasia	BEFREE	30141626		★☆☆☆☆ Found in Text Mining only
Premature adrenarche	Premature adrenarche	BEFREE	30566905		★☆☆☆☆ Found in Text Mining only
Primary biliary cirrhosis	Biliary Cirrhosis	BEFREE	17696930, 26504856		★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	26504856		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	17287403		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16617014, 18450964, 20621111, 30890759, 9566751		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	21716162		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22542949	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
prostatitis	Prostatitis	BEFREE	28886262		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	29335782		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	11341297		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10553979, 28831053, 29667557		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30557606		★☆☆☆☆ Found in Text Mining only
Spondyloepiphyseal Dysplasia	Spondyloepiphyseal dysplasia	BEFREE	15895462		★☆☆☆☆ Found in Text Mining only
Spondyloepiphyseal dysplasia, congenita	Spondyloepiphyseal dysplasia congenita	BEFREE	15895462		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31557242		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	31092091		★☆☆☆☆ Found in Text Mining only
Stickler syndrome (disorder)	Stickler syndrome	BEFREE	15895462		★☆☆☆☆ Found in Text Mining only
Stickler syndrome, type 1	Stickler syndrome	BEFREE	15895462		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	2895649, 2953031		★☆☆☆☆ Found in Text Mining only
Subfertility	Subfertility	BEFREE	26656886		★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	BEFREE	30658614		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	8957092		★☆☆☆☆ Found in Text Mining only