Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	682
Gene name	Basigin (Ok blood group)
Gene symbol	BSG
Synonyms (NCBI Gene)	5F7CD147EMMPRINEMPRINHAb18GOKTCSF
Chromosome	19
Chromosome location	19p13.3
Summary	The protein encoded by this gene, basigin, is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. Basigin is also a member of the immunoglobulin superfamily, ubiquitously ex

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs104894669	G>A	Affects	5 prime UTR variant, coding sequence variant, missense variant

339

Show/Hide all (339)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048970	hsa-miR-92a-3p	CLASH	23622248
MIRT048970	hsa-miR-92a-3p	CLASH	23622248
MIRT044060	hsa-miR-361-5p	CLASH	23622248
MIRT043789	hsa-miR-328-3p	CLASH	23622248
MIRT438122	hsa-miR-22-3p	Luciferase reporter assay	24906624
MIRT438122	hsa-miR-22-3p	Luciferase reporter assay	24906624
MIRT438122	hsa-miR-22-3p	Luciferase reporter assay	24906624
MIRT438122	hsa-miR-22-3p	Luciferase reporter assay	24906624
MIRT728194	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT728195	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT728193	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT728192	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT438122	hsa-miR-22-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	28184176
MIRT438122	hsa-miR-22-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	28184176
MIRT756032	hsa-miR-340-5p	Luciferase reporter assayWestern blottingqRT-PCR	34993704
MIRT825998	hsa-miR-1197	CLIP-seq
MIRT825999	hsa-miR-1249	CLIP-seq
MIRT826000	hsa-miR-125a-5p	CLIP-seq
MIRT826001	hsa-miR-125b	CLIP-seq
MIRT826002	hsa-miR-1272	CLIP-seq
MIRT826003	hsa-miR-1286	CLIP-seq
MIRT826004	hsa-miR-1322	CLIP-seq
MIRT826005	hsa-miR-1324	CLIP-seq
MIRT826006	hsa-miR-134	CLIP-seq
MIRT826007	hsa-miR-146a	CLIP-seq
MIRT826008	hsa-miR-146b-5p	CLIP-seq
MIRT826009	hsa-miR-2467-5p	CLIP-seq
MIRT826010	hsa-miR-296-5p	CLIP-seq
MIRT826011	hsa-miR-3118	CLIP-seq
MIRT826012	hsa-miR-3140-5p	CLIP-seq
MIRT826013	hsa-miR-3164	CLIP-seq
MIRT826014	hsa-miR-3174	CLIP-seq
MIRT826015	hsa-miR-3188	CLIP-seq
MIRT826016	hsa-miR-3658	CLIP-seq
MIRT826017	hsa-miR-3661	CLIP-seq
MIRT826018	hsa-miR-3673	CLIP-seq
MIRT826019	hsa-miR-3909	CLIP-seq
MIRT826020	hsa-miR-3926	CLIP-seq
MIRT826021	hsa-miR-3929	CLIP-seq
MIRT826022	hsa-miR-3975	CLIP-seq
MIRT826023	hsa-miR-4265	CLIP-seq
MIRT826024	hsa-miR-4296	CLIP-seq
MIRT826025	hsa-miR-4310	CLIP-seq
MIRT826026	hsa-miR-4319	CLIP-seq
MIRT826027	hsa-miR-4322	CLIP-seq
MIRT826028	hsa-miR-4417	CLIP-seq
MIRT826029	hsa-miR-4419b	CLIP-seq
MIRT826030	hsa-miR-4436a	CLIP-seq
MIRT826031	hsa-miR-4462	CLIP-seq
MIRT826032	hsa-miR-4478	CLIP-seq
MIRT826033	hsa-miR-4514	CLIP-seq
MIRT826034	hsa-miR-4521	CLIP-seq
MIRT826035	hsa-miR-4649-3p	CLIP-seq
MIRT826036	hsa-miR-4651	CLIP-seq
MIRT826037	hsa-miR-4655-3p	CLIP-seq
MIRT826038	hsa-miR-4692	CLIP-seq
MIRT826039	hsa-miR-4732-3p	CLIP-seq
MIRT826040	hsa-miR-4749-3p	CLIP-seq
MIRT826041	hsa-miR-4785	CLIP-seq
MIRT826042	hsa-miR-4790-3p	CLIP-seq
MIRT826043	hsa-miR-485-5p	CLIP-seq
MIRT826044	hsa-miR-544b	CLIP-seq
MIRT826045	hsa-miR-548s	CLIP-seq
MIRT826046	hsa-miR-589	CLIP-seq
MIRT826047	hsa-miR-602	CLIP-seq
MIRT826048	hsa-miR-608	CLIP-seq
MIRT826049	hsa-miR-629	CLIP-seq
MIRT826050	hsa-miR-631	CLIP-seq
MIRT826051	hsa-miR-663b	CLIP-seq
MIRT826052	hsa-miR-670	CLIP-seq
MIRT826053	hsa-miR-759	CLIP-seq
MIRT826054	hsa-miR-890	CLIP-seq
MIRT826055	hsa-miR-940	CLIP-seq
MIRT826014	hsa-miR-3174	CLIP-seq
MIRT826019	hsa-miR-3909	CLIP-seq
MIRT826020	hsa-miR-3926	CLIP-seq
MIRT826045	hsa-miR-548s	CLIP-seq
MIRT826051	hsa-miR-663b	CLIP-seq
MIRT826018	hsa-miR-3673	CLIP-seq
MIRT825998	hsa-miR-1197	CLIP-seq
MIRT1944235	hsa-miR-1225-3p	CLIP-seq
MIRT1944236	hsa-miR-1233	CLIP-seq
MIRT825999	hsa-miR-1249	CLIP-seq
MIRT1944237	hsa-miR-1252	CLIP-seq
MIRT826000	hsa-miR-125a-5p	CLIP-seq
MIRT826001	hsa-miR-125b	CLIP-seq
MIRT1944238	hsa-miR-1260	CLIP-seq
MIRT1944239	hsa-miR-1260b	CLIP-seq
MIRT826003	hsa-miR-1286	CLIP-seq
MIRT1944240	hsa-miR-1304	CLIP-seq
MIRT826005	hsa-miR-1324	CLIP-seq
MIRT826006	hsa-miR-134	CLIP-seq
MIRT826007	hsa-miR-146a	CLIP-seq
MIRT826008	hsa-miR-146b-5p	CLIP-seq
MIRT1944241	hsa-miR-188-3p	CLIP-seq
MIRT1944242	hsa-miR-1913	CLIP-seq
MIRT1944243	hsa-miR-22	CLIP-seq
MIRT826009	hsa-miR-2467-5p	CLIP-seq
MIRT826010	hsa-miR-296-5p	CLIP-seq
MIRT826011	hsa-miR-3118	CLIP-seq
MIRT1944244	hsa-miR-3156-3p	CLIP-seq
MIRT826013	hsa-miR-3164	CLIP-seq
MIRT1944245	hsa-miR-3181	CLIP-seq
MIRT1944246	hsa-miR-324-3p	CLIP-seq
MIRT826016	hsa-miR-3658	CLIP-seq
MIRT826017	hsa-miR-3661	CLIP-seq
MIRT826018	hsa-miR-3673	CLIP-seq
MIRT1944247	hsa-miR-3689a-3p	CLIP-seq
MIRT1944248	hsa-miR-3689c	CLIP-seq
MIRT1944249	hsa-miR-3907	CLIP-seq
MIRT826022	hsa-miR-3975	CLIP-seq
MIRT1944250	hsa-miR-3976	CLIP-seq
MIRT826023	hsa-miR-4265	CLIP-seq
MIRT1944251	hsa-miR-4270	CLIP-seq
MIRT826024	hsa-miR-4296	CLIP-seq
MIRT826025	hsa-miR-4310	CLIP-seq
MIRT1944252	hsa-miR-4313	CLIP-seq
MIRT826026	hsa-miR-4319	CLIP-seq
MIRT826027	hsa-miR-4322	CLIP-seq
MIRT826028	hsa-miR-4417	CLIP-seq
MIRT826030	hsa-miR-4436a	CLIP-seq
MIRT1944253	hsa-miR-4436b-3p	CLIP-seq
MIRT1944254	hsa-miR-4441	CLIP-seq
MIRT826031	hsa-miR-4462	CLIP-seq
MIRT826033	hsa-miR-4514	CLIP-seq
MIRT1944255	hsa-miR-4532	CLIP-seq
MIRT1944256	hsa-miR-4640-3p	CLIP-seq
MIRT826036	hsa-miR-4651	CLIP-seq
MIRT826037	hsa-miR-4655-3p	CLIP-seq
MIRT1944257	hsa-miR-4660	CLIP-seq
MIRT826038	hsa-miR-4692	CLIP-seq
MIRT1944258	hsa-miR-4728-5p	CLIP-seq
MIRT826039	hsa-miR-4732-3p	CLIP-seq
MIRT826040	hsa-miR-4749-3p	CLIP-seq
MIRT826043	hsa-miR-485-5p	CLIP-seq
MIRT1944259	hsa-miR-494	CLIP-seq
MIRT1944260	hsa-miR-520a-5p	CLIP-seq
MIRT1944261	hsa-miR-525-5p	CLIP-seq
MIRT1944262	hsa-miR-548q	CLIP-seq
MIRT1944263	hsa-miR-558	CLIP-seq
MIRT826046	hsa-miR-589	CLIP-seq
MIRT826047	hsa-miR-602	CLIP-seq
MIRT826048	hsa-miR-608	CLIP-seq
MIRT826049	hsa-miR-629	CLIP-seq
MIRT826050	hsa-miR-631	CLIP-seq
MIRT1944264	hsa-miR-646	CLIP-seq
MIRT1944265	hsa-miR-662	CLIP-seq
MIRT826052	hsa-miR-670	CLIP-seq
MIRT826053	hsa-miR-759	CLIP-seq
MIRT826054	hsa-miR-890	CLIP-seq
MIRT826055	hsa-miR-940	CLIP-seq
MIRT1944235	hsa-miR-1225-3p	CLIP-seq
MIRT1944236	hsa-miR-1233	CLIP-seq
MIRT1944238	hsa-miR-1260	CLIP-seq
MIRT1944239	hsa-miR-1260b	CLIP-seq
MIRT2182790	hsa-miR-1293	CLIP-seq
MIRT1944240	hsa-miR-1304	CLIP-seq
MIRT826005	hsa-miR-1324	CLIP-seq
MIRT826006	hsa-miR-134	CLIP-seq
MIRT1944241	hsa-miR-188-3p	CLIP-seq
MIRT2182791	hsa-miR-1912	CLIP-seq
MIRT2182792	hsa-miR-2355-5p	CLIP-seq
MIRT826009	hsa-miR-2467-5p	CLIP-seq
MIRT826011	hsa-miR-3118	CLIP-seq
MIRT1944244	hsa-miR-3156-3p	CLIP-seq
MIRT826013	hsa-miR-3164	CLIP-seq
MIRT826015	hsa-miR-3188	CLIP-seq
MIRT2182793	hsa-miR-3192	CLIP-seq
MIRT826017	hsa-miR-3661	CLIP-seq
MIRT1944247	hsa-miR-3689a-3p	CLIP-seq
MIRT1944248	hsa-miR-3689c	CLIP-seq
MIRT2182794	hsa-miR-3692	CLIP-seq
MIRT1944249	hsa-miR-3907	CLIP-seq
MIRT826021	hsa-miR-3929	CLIP-seq
MIRT2182795	hsa-miR-3960	CLIP-seq
MIRT826022	hsa-miR-3975	CLIP-seq
MIRT1944250	hsa-miR-3976	CLIP-seq
MIRT826025	hsa-miR-4310	CLIP-seq
MIRT826029	hsa-miR-4419b	CLIP-seq
MIRT2182796	hsa-miR-4467	CLIP-seq
MIRT826032	hsa-miR-4478	CLIP-seq
MIRT2182797	hsa-miR-4483	CLIP-seq
MIRT1944258	hsa-miR-4728-5p	CLIP-seq
MIRT2182798	hsa-miR-4766-5p	CLIP-seq
MIRT2182799	hsa-miR-483-5p	CLIP-seq
MIRT826043	hsa-miR-485-5p	CLIP-seq
MIRT2182800	hsa-miR-545	CLIP-seq
MIRT1944262	hsa-miR-548q	CLIP-seq
MIRT1944263	hsa-miR-558	CLIP-seq
MIRT826050	hsa-miR-631	CLIP-seq
MIRT2182801	hsa-miR-652	CLIP-seq
MIRT1944265	hsa-miR-662	CLIP-seq
MIRT825998	hsa-miR-1197	CLIP-seq
MIRT826003	hsa-miR-1286	CLIP-seq
MIRT826005	hsa-miR-1324	CLIP-seq
MIRT826025	hsa-miR-4310	CLIP-seq
MIRT826030	hsa-miR-4436a	CLIP-seq
MIRT826031	hsa-miR-4462	CLIP-seq
MIRT826033	hsa-miR-4514	CLIP-seq
MIRT826038	hsa-miR-4692	CLIP-seq
MIRT826047	hsa-miR-602	CLIP-seq
MIRT2182801	hsa-miR-652	CLIP-seq
MIRT826055	hsa-miR-940	CLIP-seq
MIRT825999	hsa-miR-1249	CLIP-seq
MIRT2182791	hsa-miR-1912	CLIP-seq
MIRT826009	hsa-miR-2467-5p	CLIP-seq
MIRT826015	hsa-miR-3188	CLIP-seq
MIRT826021	hsa-miR-3929	CLIP-seq
MIRT826022	hsa-miR-3975	CLIP-seq
MIRT826023	hsa-miR-4265	CLIP-seq
MIRT826024	hsa-miR-4296	CLIP-seq
MIRT826027	hsa-miR-4322	CLIP-seq
MIRT826028	hsa-miR-4417	CLIP-seq
MIRT826029	hsa-miR-4419b	CLIP-seq
MIRT2435819	hsa-miR-4434	CLIP-seq
MIRT1944253	hsa-miR-4436b-3p	CLIP-seq
MIRT826032	hsa-miR-4478	CLIP-seq
MIRT2435820	hsa-miR-4516	CLIP-seq
MIRT2435821	hsa-miR-4531	CLIP-seq
MIRT1944255	hsa-miR-4532	CLIP-seq
MIRT2435822	hsa-miR-4632	CLIP-seq
MIRT1944257	hsa-miR-4660	CLIP-seq
MIRT2182798	hsa-miR-4766-5p	CLIP-seq
MIRT2182799	hsa-miR-483-5p	CLIP-seq
MIRT826043	hsa-miR-485-5p	CLIP-seq
MIRT1944259	hsa-miR-494	CLIP-seq
MIRT1944264	hsa-miR-646	CLIP-seq
MIRT2435823	hsa-miR-941	CLIP-seq
MIRT825998	hsa-miR-1197	CLIP-seq
MIRT2486407	hsa-miR-1204	CLIP-seq
MIRT825999	hsa-miR-1249	CLIP-seq
MIRT826000	hsa-miR-125a-5p	CLIP-seq
MIRT826001	hsa-miR-125b	CLIP-seq
MIRT826003	hsa-miR-1286	CLIP-seq
MIRT2486408	hsa-miR-1291	CLIP-seq
MIRT826005	hsa-miR-1324	CLIP-seq
MIRT2182791	hsa-miR-1912	CLIP-seq
MIRT826009	hsa-miR-2467-5p	CLIP-seq
MIRT2486409	hsa-miR-3163	CLIP-seq
MIRT826014	hsa-miR-3174	CLIP-seq
MIRT826015	hsa-miR-3188	CLIP-seq
MIRT2486410	hsa-miR-328	CLIP-seq
MIRT2486411	hsa-miR-345	CLIP-seq
MIRT826019	hsa-miR-3909	CLIP-seq
MIRT826020	hsa-miR-3926	CLIP-seq
MIRT826021	hsa-miR-3929	CLIP-seq
MIRT2182795	hsa-miR-3960	CLIP-seq
MIRT826022	hsa-miR-3975	CLIP-seq
MIRT826023	hsa-miR-4265	CLIP-seq
MIRT2486412	hsa-miR-4282	CLIP-seq
MIRT826024	hsa-miR-4296	CLIP-seq
MIRT826025	hsa-miR-4310	CLIP-seq
MIRT826026	hsa-miR-4319	CLIP-seq
MIRT826027	hsa-miR-4322	CLIP-seq
MIRT826028	hsa-miR-4417	CLIP-seq
MIRT826029	hsa-miR-4419b	CLIP-seq
MIRT2435819	hsa-miR-4434	CLIP-seq
MIRT826030	hsa-miR-4436a	CLIP-seq
MIRT1944253	hsa-miR-4436b-3p	CLIP-seq
MIRT2182796	hsa-miR-4467	CLIP-seq
MIRT826032	hsa-miR-4478	CLIP-seq
MIRT826033	hsa-miR-4514	CLIP-seq
MIRT2435820	hsa-miR-4516	CLIP-seq
MIRT2435821	hsa-miR-4531	CLIP-seq
MIRT2435822	hsa-miR-4632	CLIP-seq
MIRT826035	hsa-miR-4649-3p	CLIP-seq
MIRT1944257	hsa-miR-4660	CLIP-seq
MIRT826038	hsa-miR-4692	CLIP-seq
MIRT826039	hsa-miR-4732-3p	CLIP-seq
MIRT2182798	hsa-miR-4766-5p	CLIP-seq
MIRT826041	hsa-miR-4785	CLIP-seq
MIRT2486413	hsa-miR-4803	CLIP-seq
MIRT2182799	hsa-miR-483-5p	CLIP-seq
MIRT826043	hsa-miR-485-5p	CLIP-seq
MIRT826044	hsa-miR-544b	CLIP-seq
MIRT826045	hsa-miR-548s	CLIP-seq
MIRT1944264	hsa-miR-646	CLIP-seq
MIRT2182801	hsa-miR-652	CLIP-seq
MIRT826051	hsa-miR-663b	CLIP-seq
MIRT826052	hsa-miR-670	CLIP-seq
MIRT826053	hsa-miR-759	CLIP-seq
MIRT826055	hsa-miR-940	CLIP-seq
MIRT2435823	hsa-miR-941	CLIP-seq
MIRT825998	hsa-miR-1197	CLIP-seq
MIRT2486407	hsa-miR-1204	CLIP-seq
MIRT825999	hsa-miR-1249	CLIP-seq
MIRT826000	hsa-miR-125a-5p	CLIP-seq
MIRT826001	hsa-miR-125b	CLIP-seq
MIRT826003	hsa-miR-1286	CLIP-seq
MIRT2486408	hsa-miR-1291	CLIP-seq
MIRT826005	hsa-miR-1324	CLIP-seq
MIRT2182791	hsa-miR-1912	CLIP-seq
MIRT826009	hsa-miR-2467-5p	CLIP-seq
MIRT2486409	hsa-miR-3163	CLIP-seq
MIRT826013	hsa-miR-3164	CLIP-seq
MIRT2676072	hsa-miR-3173-3p	CLIP-seq
MIRT826014	hsa-miR-3174	CLIP-seq
MIRT826015	hsa-miR-3188	CLIP-seq
MIRT2486410	hsa-miR-328	CLIP-seq
MIRT1944247	hsa-miR-3689a-3p	CLIP-seq
MIRT1944248	hsa-miR-3689c	CLIP-seq
MIRT826019	hsa-miR-3909	CLIP-seq
MIRT826020	hsa-miR-3926	CLIP-seq
MIRT826021	hsa-miR-3929	CLIP-seq
MIRT826022	hsa-miR-3975	CLIP-seq
MIRT826023	hsa-miR-4265	CLIP-seq
MIRT2486412	hsa-miR-4282	CLIP-seq
MIRT826024	hsa-miR-4296	CLIP-seq
MIRT826025	hsa-miR-4310	CLIP-seq
MIRT826026	hsa-miR-4319	CLIP-seq
MIRT826027	hsa-miR-4322	CLIP-seq
MIRT826028	hsa-miR-4417	CLIP-seq
MIRT826029	hsa-miR-4419b	CLIP-seq
MIRT2435819	hsa-miR-4434	CLIP-seq
MIRT826030	hsa-miR-4436a	CLIP-seq
MIRT826031	hsa-miR-4462	CLIP-seq
MIRT826032	hsa-miR-4478	CLIP-seq
MIRT826033	hsa-miR-4514	CLIP-seq
MIRT2435820	hsa-miR-4516	CLIP-seq
MIRT2435821	hsa-miR-4531	CLIP-seq
MIRT2435822	hsa-miR-4632	CLIP-seq
MIRT826035	hsa-miR-4649-3p	CLIP-seq
MIRT826038	hsa-miR-4692	CLIP-seq
MIRT826039	hsa-miR-4732-3p	CLIP-seq
MIRT2182798	hsa-miR-4766-5p	CLIP-seq
MIRT2676073	hsa-miR-4779	CLIP-seq
MIRT826041	hsa-miR-4785	CLIP-seq
MIRT2486413	hsa-miR-4803	CLIP-seq
MIRT2182799	hsa-miR-483-5p	CLIP-seq
MIRT826043	hsa-miR-485-5p	CLIP-seq
MIRT826044	hsa-miR-544b	CLIP-seq
MIRT826045	hsa-miR-548s	CLIP-seq
MIRT826047	hsa-miR-602	CLIP-seq
MIRT2182801	hsa-miR-652	CLIP-seq
MIRT826051	hsa-miR-663b	CLIP-seq
MIRT826052	hsa-miR-670	CLIP-seq
MIRT826053	hsa-miR-759	CLIP-seq
MIRT826055	hsa-miR-940	CLIP-seq
MIRT2435823	hsa-miR-941	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
AR	Unknown	14633669
SP1	Activation	11814679;20384626;20629990
SP3	Activation	11814679

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	TAS
GO:0001525	Process	Angiogenesis	IEA
GO:0001618	Function	Virus receptor activity	IEA
GO:0001618	Function	Virus receptor activity	IMP	20147391
GO:0001750	Component	Photoreceptor outer segment	IEA
GO:0001750	Component	Photoreceptor outer segment	ISS
GO:0001917	Component	Photoreceptor inner segment	IEA
GO:0001917	Component	Photoreceptor inner segment	ISS
GO:0002080	Component	Acrosomal membrane	IEA
GO:0003407	Process	Neural retina development	ISS
GO:0005515	Function	Protein binding	IPI	11353871, 11943775, 15688292, 15890777, 15946952, 17127621, 17267690, 21245143, 22080952, 24297912, 25132548, 25296023, 25825981, 25957687, 26195724, 28096331, 28186186, 28666119, 29423001, 30542156, 32296183, 33277466, 33961781, 34819669, 37158588
GO:0005537	Function	D-mannose binding	IEA
GO:0005739	Component	Mitochondrion	HDA	20833797
GO:0005768	Component	Endosome	IDA	29739904
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	15688292
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005886	Component	Plasma membrane	HDA	16791210
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	11992541, 15688292, 15946952, 25825981, 26195724, 29739904
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA
GO:0007166	Process	Cell surface receptor signaling pathway	TAS	9767135
GO:0007411	Process	Axon guidance	IBA
GO:0007566	Process	Embryo implantation	IEA
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IDA	19837976
GO:0010575	Process	Positive regulation of vascular endothelial growth factor production	IMP	15833850
GO:0010595	Process	Positive regulation of endothelial cell migration	IDA	19837976
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030424	Component	Axon	IBA
GO:0030593	Process	Neutrophil chemotaxis	IMP	11943775
GO:0032755	Process	Positive regulation of interleukin-6 production	IDA	21620857
GO:0038023	Function	Signaling receptor activity	IDA	11688976, 25957687
GO:0042383	Component	Sarcolemma	IEA
GO:0042470	Component	Melanosome	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0042995	Component	Cell projection	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0045494	Process	Photoreceptor cell maintenance	IDA	25957687
GO:0045494	Process	Photoreceptor cell maintenance	IDA	25957687
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	29739904
GO:0046598	Process	Positive regulation of viral entry into host cell	IMP	11353871, 15688292
GO:0046689	Process	Response to mercury ion	IEA
GO:0046697	Process	Decidualization	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0061154	Process	Endothelial tube morphogenesis	IDA	19837976
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070593	Process	Dendrite self-avoidance	IBA
GO:0072659	Process	Protein localization to plasma membrane	IEA
GO:0072659	Process	Protein localization to plasma membrane	IMP	29088427
GO:0072659	Process	Protein localization to plasma membrane	ISS
GO:0098632	Function	Cell-cell adhesion mediator activity	IBA
GO:1904466	Process	Positive regulation of matrix metallopeptidase secretion	IDA	12553375
GO:1904466	Process	Positive regulation of matrix metallopeptidase secretion	IMP	11992541, 15833850
GO:1990138	Process	Neuron projection extension	ISS

MIM	HGNC	e!Ensembl
109480	1116	ENSG00000172270

P35613

Protein name

Basigin (5F7) (Collagenase stimulatory factor) (Extracellular matrix metalloproteinase inducer) (EMMPRIN) (Hepatoma-associated antigen) (HAb18G) (Leukocyte activation antigen M6) (OK blood group antigen) (Tumor cell-derived collagenase stimulatory factor)

Protein function

[Isoform 1]: Essential for normal retinal maturation and development (By similarity). Acts as a retinal cell surface receptor for NXNL1 and plays an important role in NXNL1-mediated survival of retinal cone photoreceptors (PubMed:25957687). In a

PDB

3B5H , 3I84 , 3I85 , 3QQN , 3QR2 , 4U0Q , 5X0T , 5XF0 , 6LYY , 6LZ0 , 7CKO , 7CKR , 7DA5 , 7DAA , 7DCE , 7XY8 , 8XEJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13927	Ig_3	25 → 112		Domain
PF13927	Ig_3	220 → 305		Domain

Tissue specificity

TISSUE SPECIFICITY: [Isoform 1]: Retina-specific (PubMed:25957687). Expressed in retinal cone photoreceptors (at protein level) (PubMed:25957687). {ECO:0000269|PubMed:25957687}.; TISSUE SPECIFICITY: [Isoform 2]: Expressed in erythrocytes (at protein level

Sequence

MAAALFVLLGFALLGTHGASGAAGFVQAPLSQQRWVGGSVELHCEAVGSPVPEIQWWFEG
QGPNDTCSQLWDGARLDRVHIHATYHQHAASTISIDTLVEEDTGTYECRASNDPDRNHLT
RAPRVKWVRAQAVVLVLEPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKE
DALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAML
VCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYR
CNGTSSKGSDQAIITLRVRSHLAALWPFLGIVAEVLVLVTIIFIYEKRRKPEDVLDDDDA
GSAPLKSSGQHQNDKGKNVRQRNSS

Sequence length

385

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis		Degradation of the extracellular matrix Basigin interactions Integrin cell surface interactions Proton-coupled monocarboxylate transport Defective SLC16A1 causes symptomatic deficiency in lactate transport (SDLT) Pyruvate metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (22)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BLOOD GROUP--OK	Affects	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BSG-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOTOR NEURON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary renal cell carcinoma type 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (332)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	26496256, 28230811, 29563383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	18160808, 18567995		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18665036, 22592183, 26525902, 29431238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	25403912		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26284589, 31497203, 31565568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	28337279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	20514493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolar Soft Part Sarcoma	Alveolar Sarcoma	BEFREE	21835426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	15890777, 22084929, 34108016	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	31401349		★★★★★ ★☆☆☆☆ Found in Text Mining only
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	CTD_human_DG	11796754		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	CTD_human_DG	11796754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	CTD_human_DG	11796754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	23966157, 27041581		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30272291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	18322255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	31936351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Thoracic	Thoracic aortic aneurysm	Pubtator	31936351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic valve calcification	Aortic valve calcification	BEFREE	21146836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	21146836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18048771, 19561311, 24392813, 28582638, 29154780, 29419744, 30039437, 30347750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	LHGDN	16207318		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29852454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	33193313	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10693866, 20455995	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	11840439, 15946952, 16207318, 16507143, 18567920, 25404518, 26296700, 29563614, 33193313, 34975837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30068332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	32496587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10962435, 23817808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	23516431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	12526080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18048771, 19561311, 24392813, 28582638, 29154780, 29419744, 30039437, 30347750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19561311, 26496256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	25404518, 29563614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	29563614, 30619283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	23966157		★★★★★ ★☆☆☆☆ Found in Text Mining only
beta Thalassemia	Beta thalassemia	Pubtator	35624125	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	18688595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21613799, 25263481, 28927069, 28977970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	34710269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	20455995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Neoplasms	Bone neoplasm	Pubtator	30043854	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	22575025	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	23817808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10355528, 16443928, 20631064, 21870331, 23474495, 23623923, 23888049, 24174370, 24906624, 25269858, 25862460, 26634540, 27325313, 27434292, 29202620 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16443928, 17441962, 17725804, 22389410, 23474495, 23888049, 25503107, 26634540, 26722437, 27325313, 28333070, 28465354, 29901696, 37648771, 38066486, 9154157 View all (1 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	18273614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	25813864, 30463017, 35464411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	19286191, 21613799, 22678117, 24073208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	21448785	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	25755717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	22200897, 26349748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	9284814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11591720, 14562372, 15316657, 15770719, 16775432, 18430721, 18695939, 18847500, 19298604, 19775453, 20629990, 21443647, 23950866, 24996644, 25033086 View all (11 more)	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17589939	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	19286191, 21613799, 25263481, 28358415, 28927069, 28977970, 31607136		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	21165561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17678621, 20384626, 20514014, 23005037, 25084765, 25894929, 28356976, 28433697, 29431238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	17460779, 17962725, 23566400, 23966157, 24374756, 27863372, 29267289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	30816446	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	24131772, 26384346, 27494883, 32754264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	18751374, 22575025, 24817962, 28631562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	19597291	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12705637, 16930823, 23221648, 23966157, 25998266, 27863372, 28056551, 30816446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	25294955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	35372112	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28993547, 29419744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	31936351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	18567920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	24392813, 28582638, 29114092, 31666088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30039437, 31447768		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21687950, 28118037		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	21687950, 28118037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chagas Disease	Chagas disease	Pubtator	35372112	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	19629755, 34948304	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28244853, 31729681		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic heart failure	Heart Failure	BEFREE	28230811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29234893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	26005854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	30727993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	25076423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30619283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	32853407	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	18508606, 25862460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	17264401, 40156418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20514493, 25550778, 26316167, 26397886, 26507719, 29532886		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17264401, 19569245, 22782346, 25550778, 26507719, 27460659, 28874966, 36303457, 39195201, 40156418	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	27411985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28244853, 31729681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28230811, 28993547, 29772453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19548138, 24073208, 25456395, 26384346, 28881651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal disease	Pubtator	15632013	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal Ulcer	BEFREE	29340650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28230811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	19995409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28158393, 28230811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	28230811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28230811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	32853407	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10693866, 11840439, 16507143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	27388991, 28272440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27860331, 30953513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27860331, 30953513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	36303457, 37576973	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28666119, 30572748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	33053534	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29234893, 30572748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	27917946		★★★★★ ★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	17962725	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	28551820		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	36574092	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	31666088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	29630856		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22640183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	16522689, 24661733, 25996258, 29630856, 31600731		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	16876164, 24661733, 29630856	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	GWASCAT_DG	28881265		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epiphyseal dysplasia multiple 1	Epiphyseal dysplasia	Pubtator	15201341	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27863372, 30816446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21789540, 26458866, 27420938, 28700599, 31411555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21789540, 26458866, 27420938, 28700599, 31411555		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27420938, 34997863	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	15372476, 27420938, 33149553, 34997863	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroatheroma	Fibroatheroma	CTD_human_DG	18647594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	11839585, 26559755, 29642635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	31014956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	22280229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	22280229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	29034777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	29034777	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22281667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Genetic Predisposition to Disease	Genetic predisposition to disease	Pubtator	32492203	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	29755659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	26202356, 26339416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	16205625	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15970688, 24225180, 32033611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23258846, 23817808, 23925827, 25403912, 28655889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	23817808, 23925827, 25403912, 28655889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10962435, 23817808, 26284589, 27206428, 27761842, 28560663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23516431, 30942433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	32775435	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type IV	Glycogen storage disease	Pubtator	24374756	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	24705283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	20700044, 24705283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	17945211		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28230811	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	28230811	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28993547, 29772453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	34360654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	25206282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	12174874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	28230811, 32496587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	25149188, 28230811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	16754474	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	29234893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	25977287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	20631064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36303457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32714980, 32853407, 33015178	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	27388991		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	16714395, 18266006	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	29114092, 31356925, 31666088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	26675551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	LHGDN	12174874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	28581487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29234893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29234893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	35050463	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	LHGDN	14729463		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	24357157	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	24993241, 25260396, 26024713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24993241, 30467201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	30467201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25260396, 30467201		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	16310185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	28631562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14562372, 17327467, 17589939, 18847500, 19093255, 19298604, 19615356, 20549347, 20629990, 21536654, 22130661, 22555451, 22595757, 23182495, 23950866 View all (29 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	15770719, 18847500, 19093255		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	11839585	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	25076423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	10693866, 11840439	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	17327467, 19298604, 22555451, 28487989, 31203955		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	16867869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20384626, 37167549, 8752667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	9877171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	17488482		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	20236683		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24019861, 24357157, 24793016, 25550778, 25973085, 26507719, 35132181	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	25421538, 29282042, 31497203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29282042	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	18608214, 25260396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	30043854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10962435		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	24705283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16443928, 20631064, 21870331, 23474495, 23623923, 23888049, 24174370, 24906624, 25862460, 26634540, 27325313, 27434292, 29202620, 29731886, 29807951, 29901696, 30022447, 30099407 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21789540, 26458866, 27420938, 28700599, 31411555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28571672, 31752956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17678621, 20384626, 20514014, 23005037, 25084765, 25894929, 28433697, 29431238		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	28631562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12705637, 16930823, 23221648, 23966157, 25998266, 27863372, 28056551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	16604531, 22427101, 24132924, 27556697, 28039486, 30274301, 31312365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16627983, 20370680, 21563192, 22870202, 23948277, 25813864, 26125892, 26209327, 26286430, 26891801, 28121354, 31013576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	28789363, 28832687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19628385, 20525232, 23828593, 24979746, 28427166, 29163835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29634399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21613799, 25263481, 28927069, 28977970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11395366, 12705637, 16443928, 17210677, 17460779, 17589939, 17945211, 18508606, 19223118, 19391040, 19541433, 20384626, 20514014, 20514493, 20824203 View all (68 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21687950, 28118037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	18508606, 25862460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15161697, 16721788, 17725804, 19176383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	27434292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	31149040, 31936351	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	21448785	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	11992541, 17145878		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	17145878, 20824203, 23879967, 24090196, 25470292, 25807898, 27556188, 28445958, 28612997, 28699528, 28832687, 30253283, 30272281		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	28832687	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meningioma	Meningioma	BEFREE	23817808, 27779709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	22619123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	25191702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	20370680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	16876164, 21787388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	18751374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27232157, 32673940	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22460757, 24013424, 25015330, 26005854, 26268417, 28017969, 29695106, 30741931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	22460757	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24013424, 25015330, 26268417, 27769052, 34768284, 36359760	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	27727297	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	27733550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	34360654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	29599206		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	18048771	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28429960, 29419744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	28373534, 35002215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	20969816		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	37519135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	19582878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	21448785	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11395366, 12553375, 12705637, 12893184, 14985463, 15833850, 16002723, 17069593, 17210677, 17460779, 17589939, 17945211, 18508606, 18689982, 18847500 View all (88 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24069378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	24069378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	16619545	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	29118919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25084765, 25894929, 28445149, 29282042, 30320488, 30816543, 31010682		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32496587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ocular Cicatricial Pemphigoid	Ocular Cicatricial Pemphigoid	BEFREE	30904547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	29457855		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	21953087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22274866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24481662	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	12705637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	16876164, 24661733	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16930823, 23221648, 25998266, 27863372, 28056551		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	17460779, 17962725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	16876164, 17460779, 17611393, 20454640, 27863372, 30816446, 36930892	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23966157, 24374756	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	16604531, 22427101, 24132924, 27556697, 28039486, 30274301, 31312365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	31312365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	16604531	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	28028797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	36303457	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	21835259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	21835259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	21835259, 28198555, 29315565, 29900539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	21835259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	27860331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	23895705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	35477803	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	27860331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16627983, 19286191, 20370680, 21563192, 22870202, 23948277, 25813864, 26125892, 26209327, 26286430, 26891801, 28121354, 31013576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16627983, 18273614, 18852494		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16627983, 18273614, 19048397, 21563192, 21787388, 25381222, 25813864, 28121354, 31013576	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26209327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	26209327	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21655935, 28272440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30727993	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32496587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	33978304	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	12714350		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	16754474	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	24932516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	30476069		★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	25053832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	19286191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	16771728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	19286191, 19548138, 24073208, 25456395, 28881651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29234893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28661035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	25957687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	21620857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	35892564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10693866, 11840439, 16507143, 20455995, 23146660, 25053832, 25404518, 26296700, 27859685, 28948414, 29563614, 29852454, 31089921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16507143		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	31510956	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	11943706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	21918972, 22186301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17123723		★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	24608032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	34360654	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	22575025	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	28272440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	17678621, 18665036		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	12776202, 16310185, 17069593, 18751374, 19541433, 28631562, 29491054, 30275765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18816083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17069593, 21789540, 27420938, 29435035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	15831673, 18751374, 22443116, 24019861, 24386210, 24967412, 25747176, 28631562, 30275765, 30421493, 36498950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32673940	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	30303590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23413783, 24379084, 26943814, 28062212, 30421493, 30906472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	25421538, 26943814, 29085466, 30906472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19628385, 20525232, 23828593, 24979746, 28427166, 29163835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16714395, 17088917, 19569245, 20525232, 24260584, 24979746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	22626996		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	24608032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	36923215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29634399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	22280229		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	18664479		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29634399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25755717	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	32891152	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	30039437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	30039437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23263825, 31196010	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30099407, 30397860, 31196010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Calculi (disorder)	Urinary Bladder Calculi	BEFREE	31655076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28358415, 32149134, 35655727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	21613799, 22626996, 28358415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19597291, 24793016, 35043518	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	31600731		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	27255356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	32149134	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	26005854		★★★★★ ★☆☆☆☆ Found in Text Mining only

BSG (basigin (Ok blood group))