Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6814
Gene name	Syntaxin binding protein 3
Gene symbol	STXBP3
Synonyms (NCBI Gene)	MUNC18-3MUNC18CPSPUNC-18C
Chromosome	1
Chromosome location	1p13.3

174

Show/Hide all (174)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023896	hsa-miR-1-3p	Proteomics	18668040
MIRT029784	hsa-miR-26b-5p	Microarray	19088304
MIRT031842	hsa-miR-16-5p	Proteomics	18668040
MIRT043953	hsa-miR-378a-3p	CLASH	23622248
MIRT057906	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT057908	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT031842	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT057909	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT1401402	hsa-miR-101	CLIP-seq
MIRT1401403	hsa-miR-1283	CLIP-seq
MIRT1401404	hsa-miR-15a	CLIP-seq
MIRT1401405	hsa-miR-15b	CLIP-seq
MIRT1401406	hsa-miR-16	CLIP-seq
MIRT1401407	hsa-miR-195	CLIP-seq
MIRT1401408	hsa-miR-216b	CLIP-seq
MIRT1401409	hsa-miR-3124-3p	CLIP-seq
MIRT1401410	hsa-miR-3125	CLIP-seq
MIRT1401411	hsa-miR-3143	CLIP-seq
MIRT1401412	hsa-miR-329	CLIP-seq
MIRT1401413	hsa-miR-330-3p	CLIP-seq
MIRT1401414	hsa-miR-34b	CLIP-seq
MIRT1401415	hsa-miR-3613-3p	CLIP-seq
MIRT1401416	hsa-miR-362-3p	CLIP-seq
MIRT1401417	hsa-miR-3653	CLIP-seq
MIRT1401418	hsa-miR-3658	CLIP-seq
MIRT1401419	hsa-miR-3662	CLIP-seq
MIRT1401420	hsa-miR-3672	CLIP-seq
MIRT1401421	hsa-miR-3675-3p	CLIP-seq
MIRT1401422	hsa-miR-376c	CLIP-seq
MIRT1401423	hsa-miR-3916	CLIP-seq
MIRT1401424	hsa-miR-3941	CLIP-seq
MIRT1401425	hsa-miR-3942-5p	CLIP-seq
MIRT1401426	hsa-miR-424	CLIP-seq
MIRT1401427	hsa-miR-4261	CLIP-seq
MIRT1401428	hsa-miR-4291	CLIP-seq
MIRT1401429	hsa-miR-4310	CLIP-seq
MIRT1401430	hsa-miR-4328	CLIP-seq
MIRT1401431	hsa-miR-4496	CLIP-seq
MIRT1401432	hsa-miR-4506	CLIP-seq
MIRT1401433	hsa-miR-4643	CLIP-seq
MIRT1401434	hsa-miR-4659a-3p	CLIP-seq
MIRT1401435	hsa-miR-4659b-3p	CLIP-seq
MIRT1401436	hsa-miR-466	CLIP-seq
MIRT1401437	hsa-miR-4668-3p	CLIP-seq
MIRT1401438	hsa-miR-4672	CLIP-seq
MIRT1401439	hsa-miR-4680-3p	CLIP-seq
MIRT1401440	hsa-miR-4703-5p	CLIP-seq
MIRT1401441	hsa-miR-4712-5p	CLIP-seq
MIRT1401442	hsa-miR-4753-3p	CLIP-seq
MIRT1401443	hsa-miR-4760-5p	CLIP-seq
MIRT1401444	hsa-miR-4789-3p	CLIP-seq
MIRT1401445	hsa-miR-485-3p	CLIP-seq
MIRT1401446	hsa-miR-487a	CLIP-seq
MIRT1401447	hsa-miR-488	CLIP-seq
MIRT1401448	hsa-miR-497	CLIP-seq
MIRT1401449	hsa-miR-520d-5p	CLIP-seq
MIRT1401450	hsa-miR-524-5p	CLIP-seq
MIRT1401451	hsa-miR-543	CLIP-seq
MIRT1401452	hsa-miR-548ae	CLIP-seq
MIRT1401453	hsa-miR-548aj	CLIP-seq
MIRT1401454	hsa-miR-548am	CLIP-seq
MIRT1401455	hsa-miR-548g	CLIP-seq
MIRT1401456	hsa-miR-548x	CLIP-seq
MIRT1401457	hsa-miR-555	CLIP-seq
MIRT1401458	hsa-miR-582-5p	CLIP-seq
MIRT1401459	hsa-miR-590-3p	CLIP-seq
MIRT1401460	hsa-miR-603	CLIP-seq
MIRT1401461	hsa-miR-770-5p	CLIP-seq
MIRT1401462	hsa-miR-877	CLIP-seq
MIRT1401463	hsa-miR-942	CLIP-seq
MIRT1401464	hsa-miR-944	CLIP-seq
MIRT1401402	hsa-miR-101	CLIP-seq
MIRT2120368	hsa-miR-299-3p	CLIP-seq
MIRT1401412	hsa-miR-329	CLIP-seq
MIRT1401415	hsa-miR-3613-3p	CLIP-seq
MIRT1401416	hsa-miR-362-3p	CLIP-seq
MIRT1401419	hsa-miR-3662	CLIP-seq
MIRT2120369	hsa-miR-3688-5p	CLIP-seq
MIRT1401422	hsa-miR-376c	CLIP-seq
MIRT1401424	hsa-miR-3941	CLIP-seq
MIRT2120370	hsa-miR-4282	CLIP-seq
MIRT2120371	hsa-miR-4470	CLIP-seq
MIRT2120372	hsa-miR-4491	CLIP-seq
MIRT2120373	hsa-miR-4657	CLIP-seq
MIRT1401441	hsa-miR-4712-5p	CLIP-seq
MIRT1401457	hsa-miR-555	CLIP-seq
MIRT1401460	hsa-miR-603	CLIP-seq
MIRT1401461	hsa-miR-770-5p	CLIP-seq
MIRT1401403	hsa-miR-1283	CLIP-seq
MIRT1401404	hsa-miR-15a	CLIP-seq
MIRT1401405	hsa-miR-15b	CLIP-seq
MIRT1401406	hsa-miR-16	CLIP-seq
MIRT1401407	hsa-miR-195	CLIP-seq
MIRT1401410	hsa-miR-3125	CLIP-seq
MIRT1401411	hsa-miR-3143	CLIP-seq
MIRT1401413	hsa-miR-330-3p	CLIP-seq
MIRT1401419	hsa-miR-3662	CLIP-seq
MIRT1401422	hsa-miR-376c	CLIP-seq
MIRT1401423	hsa-miR-3916	CLIP-seq
MIRT1401425	hsa-miR-3942-5p	CLIP-seq
MIRT1401426	hsa-miR-424	CLIP-seq
MIRT1401427	hsa-miR-4261	CLIP-seq
MIRT1401431	hsa-miR-4496	CLIP-seq
MIRT1401432	hsa-miR-4506	CLIP-seq
MIRT1401434	hsa-miR-4659a-3p	CLIP-seq
MIRT1401435	hsa-miR-4659b-3p	CLIP-seq
MIRT1401440	hsa-miR-4703-5p	CLIP-seq
MIRT1401441	hsa-miR-4712-5p	CLIP-seq
MIRT1401445	hsa-miR-485-3p	CLIP-seq
MIRT1401446	hsa-miR-487a	CLIP-seq
MIRT1401448	hsa-miR-497	CLIP-seq
MIRT1401449	hsa-miR-520d-5p	CLIP-seq
MIRT1401450	hsa-miR-524-5p	CLIP-seq
MIRT1401451	hsa-miR-543	CLIP-seq
MIRT1401452	hsa-miR-548ae	CLIP-seq
MIRT1401453	hsa-miR-548aj	CLIP-seq
MIRT1401454	hsa-miR-548am	CLIP-seq
MIRT1401456	hsa-miR-548x	CLIP-seq
MIRT1401457	hsa-miR-555	CLIP-seq
MIRT1401461	hsa-miR-770-5p	CLIP-seq
MIRT1401462	hsa-miR-877	CLIP-seq
MIRT1401463	hsa-miR-942	CLIP-seq
MIRT1401422	hsa-miR-376c	CLIP-seq
MIRT1401432	hsa-miR-4506	CLIP-seq
MIRT1401457	hsa-miR-555	CLIP-seq
MIRT2433652	hsa-miR-2277-3p	CLIP-seq
MIRT2433653	hsa-miR-3120-3p	CLIP-seq
MIRT2433654	hsa-miR-421	CLIP-seq
MIRT2433652	hsa-miR-2277-3p	CLIP-seq
MIRT2433653	hsa-miR-3120-3p	CLIP-seq
MIRT1401411	hsa-miR-3143	CLIP-seq
MIRT2636278	hsa-miR-3163	CLIP-seq
MIRT1401417	hsa-miR-3653	CLIP-seq
MIRT1401418	hsa-miR-3658	CLIP-seq
MIRT1401420	hsa-miR-3672	CLIP-seq
MIRT1401422	hsa-miR-376c	CLIP-seq
MIRT2433654	hsa-miR-421	CLIP-seq
MIRT2636279	hsa-miR-4279	CLIP-seq
MIRT2120370	hsa-miR-4282	CLIP-seq
MIRT1401432	hsa-miR-4506	CLIP-seq
MIRT1401434	hsa-miR-4659a-3p	CLIP-seq
MIRT1401435	hsa-miR-4659b-3p	CLIP-seq
MIRT2636280	hsa-miR-4687-3p	CLIP-seq
MIRT2636281	hsa-miR-4691-5p	CLIP-seq
MIRT2636282	hsa-miR-4699-3p	CLIP-seq
MIRT1401441	hsa-miR-4712-5p	CLIP-seq
MIRT1401443	hsa-miR-4760-5p	CLIP-seq
MIRT2636283	hsa-miR-513a-3p	CLIP-seq
MIRT1401451	hsa-miR-543	CLIP-seq
MIRT1401457	hsa-miR-555	CLIP-seq
MIRT2636284	hsa-miR-587	CLIP-seq
MIRT2636285	hsa-miR-618	CLIP-seq
MIRT1401461	hsa-miR-770-5p	CLIP-seq
MIRT1401463	hsa-miR-942	CLIP-seq
MIRT2433652	hsa-miR-2277-3p	CLIP-seq
MIRT2433653	hsa-miR-3120-3p	CLIP-seq
MIRT2636278	hsa-miR-3163	CLIP-seq
MIRT1401417	hsa-miR-3653	CLIP-seq
MIRT1401418	hsa-miR-3658	CLIP-seq
MIRT1401420	hsa-miR-3672	CLIP-seq
MIRT1401422	hsa-miR-376c	CLIP-seq
MIRT2433654	hsa-miR-421	CLIP-seq
MIRT2636279	hsa-miR-4279	CLIP-seq
MIRT2120370	hsa-miR-4282	CLIP-seq
MIRT1401432	hsa-miR-4506	CLIP-seq
MIRT2636280	hsa-miR-4687-3p	CLIP-seq
MIRT2636281	hsa-miR-4691-5p	CLIP-seq
MIRT1401441	hsa-miR-4712-5p	CLIP-seq
MIRT1401443	hsa-miR-4760-5p	CLIP-seq
MIRT2636283	hsa-miR-513a-3p	CLIP-seq
MIRT1401457	hsa-miR-555	CLIP-seq
MIRT2636284	hsa-miR-587	CLIP-seq
MIRT2636285	hsa-miR-618	CLIP-seq
MIRT1401461	hsa-miR-770-5p	CLIP-seq

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001678	Process	Intracellular glucose homeostasis	IEA
GO:0005515	Function	Protein binding	IPI	12773094
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA	18588921
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	18588921
GO:0005886	Component	Plasma membrane	IEA
GO:0006886	Process	Intracellular protein transport	IBA
GO:0006887	Process	Exocytosis	IEA
GO:0006904	Process	Vesicle docking involved in exocytosis	IBA
GO:0006950	Process	Response to stress	IEA
GO:0006955	Process	Immune response	IEA
GO:0007420	Process	Brain development	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016192	Process	Vesicle-mediated transport	IEA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0017075	Function	Syntaxin-1 binding	IBA
GO:0017075	Function	Syntaxin-1 binding	IEA
GO:0019905	Function	Syntaxin binding	IEA
GO:0019905	Function	Syntaxin binding	IPI	12773094, 15576373
GO:0022615	Process	Protein to membrane docking	IEA
GO:0030073	Process	Insulin secretion	IEA
GO:0030141	Component	Secretory granule	IBA
GO:0030141	Component	Secretory granule	IEA
GO:0031091	Component	Platelet alpha granule	IDA	12773094
GO:0032868	Process	Response to insulin	IEA
GO:0042581	Component	Specific granule	IDA	18588921
GO:0043312	Process	Neutrophil degranulation	IEP	18588921
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045055	Process	Regulated exocytosis	IEA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0045955	Process	Negative regulation of calcium ion-dependent exocytosis	IMP	12649283
GO:0046325	Process	Negative regulation of D-glucose import	IEA
GO:0051051	Process	Negative regulation of transport	IEA
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070527	Process	Platelet aggregation	IMP	12773094
GO:0070820	Component	Tertiary granule	IDA	18588921
GO:0071346	Process	Cellular response to type II interferon	IEA
GO:0098793	Component	Presynapse	IEA
GO:0099525	Process	Presynaptic dense core vesicle exocytosis	IBA

MIM	HGNC	e!Ensembl
608339	11446	ENSG00000116266

O00186

Protein name

Syntaxin-binding protein 3 (Platelet Sec1 protein) (PSP) (Protein unc-18 homolog 3) (Unc18-3) (Protein unc-18 homolog C) (Unc-18C)

Protein function

Together with STX4 and VAMP2, may play a role in insulin-dependent movement of GLUT4 and in docking/fusion of intracellular GLUT4-containing vesicles with the cell surface in adipocytes.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00995	Sec1	33 → 575	Sec1 family	Family

Tissue specificity

TISSUE SPECIFICITY: Megakaryocytes and platelets.

Sequence

MAPPVAERGLKSVVWQKIKATVFDDCKKEGEWKIMLLDEFTTKLLASCCKMTDLLEEGIT
VVENIYKNREPVRQMKALYFITPTSKSVDCFLHDFASKSENKYKAAYIYFTDFCPDNLFN
KIKASCSKSIRRCKEINISFIPHESQVYTLDVPDAFYYCYSPDPGNAKGKDAIMETMADQ
IVTVCATLDENPGVRYKSKPLDNASKLAQLVEKKLEDYYKIDEKSLIKGKTHSQLLIIDR
GFDPVSTVLHELTFQAMAYDLLPIENDTYKYKTDGKEKEAILEEEDDLWVRIRHRHIAVV
LEEIPKLMKEISSTKKATEGKTSLSALTQLMKKMPHFRKQITKQVVHLNLAEDCMNKFKL
NIEKLCKTEQDLALGTDAEGQKVKDSMRVLLPVLLNKNHDNCDKIRAILLYIFSINGTTE
ENLDRLIQNVKIENESDMIRNWSYLGVPIVPQSQQGKPLRKDRSAEETFQLSRWTPFIKD
IMEDAIDNRLDSKEWPYCSQCPAVWNGSGAVSARQKPRANYLEDRKNGSKLIVFVIGGIT
YSEVRCAYEVSQAHKSCEVIIGSTHVLTPKKLLDDIKMLNKPKDKVSLIKDE

Sequence length

592

Interactions

View interactions

	Reactome
			Disinhibition of SNARE formation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Immune dysregulation, autoimmunity, and autoinflammation	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (55)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	15727931		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	24069258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	29419656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	29419656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder	Attention Deficit Hyperactivity Disorder	BEFREE	10532621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	10532621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	31216016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	28343053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34876482	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corticobasal degeneration	Corticobasal Degeneration	BEFREE	14502653, 15641585, 28207803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	14502653		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	28343053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	15641585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28568564, 30914711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28568564, 30914711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	20460426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	20460426		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	31216016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	23254636, 24086739, 28501823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	31191295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	33891011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	31091873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26916334, 28467028		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33891011	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	20460426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	22390153	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	15101498		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23484134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	21897333, 30240355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28343053		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	31216016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15727931, 24069258		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	28467028, 30726566		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	23700440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	23700440	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity Morbid	Obesity	Pubtator	23700440	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	29284677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20083340, 27614955, 29157745, 29463454, 30068492, 31299107		★★★★★ ★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	28150443, 28714593		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	15641585, 24086739, 31191295		★★★★★ ★☆☆☆☆ Found in Text Mining only
PNEUMOTHORAX, PRIMARY SPONTANEOUS	Pneumothorax	BEFREE	24121548, 28500751, 30399478, 30955098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	22390153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	14502653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Progressive Aphasia (disorder)	Aphasia	BEFREE	23254636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	14502653, 15101498, 16000317, 24121548, 27614955, 28467028, 28500751, 28951832, 29157745, 29463454, 29801913, 30068492, 30158953, 30399478, 30726566, 30955098, 31191295 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23484134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	BEFREE	28374985, 29705767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Prolapse	Rectal Prolapse	BEFREE	28374985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10532621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31621373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spontaneous pneumothorax	Spontaneous pneumothorax	BEFREE	28386166		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	30398966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	14502653, 15641585, 24086739, 28500751, 31191295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vertical supranuclear gaze palsy	Supranuclear gaze palsy	BEFREE	30068492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Wolfram Syndrome	Wolfram Syndrome	BEFREE	30914711		★★★★★ ★☆☆☆☆ Found in Text Mining only

STXBP3 (syntaxin binding protein 3)