SULT1E1 (sulfotransferase family 1E member 1)

Gene

• Entrez ID: 6783
• Gene name: Sulfotransferase family 1E member 1
• Gene symbol: SULT1E1
• Synonyms (NCBI Gene): EST, EST-1, ST1E1, STE
• Chromosome: 4
• Chromosome location: 4q13.3
• Summary: Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT007036	hsa-miR-199a-5p	Luciferase reporter assay	23060436
MIRT022279	hsa-miR-124-3p	Microarray	18668037
MIRT1402883	hsa-miR-3120-5p	CLIP-seq
MIRT1402884	hsa-miR-3125	CLIP-seq
MIRT1402885	hsa-miR-3135	CLIP-seq
MIRT1402886	hsa-miR-3173-3p	CLIP-seq
MIRT1402887	hsa-miR-3185	CLIP-seq
MIRT1402888	hsa-miR-3664-5p	CLIP-seq
MIRT1402889	hsa-miR-3672	CLIP-seq
MIRT1402890	hsa-miR-3916	CLIP-seq
MIRT1402891	hsa-miR-3922-5p	CLIP-seq
MIRT1402892	hsa-miR-4282	CLIP-seq
MIRT1402893	hsa-miR-4522	CLIP-seq
MIRT1402894	hsa-miR-4797-5p	CLIP-seq
MIRT1402895	hsa-miR-548p	CLIP-seq
MIRT1402896	hsa-miR-570	CLIP-seq
MIRT1402897	hsa-miR-627	CLIP-seq
MIRT1402898	hsa-miR-759	CLIP-seq
MIRT2120770	hsa-miR-1227	CLIP-seq
MIRT2120771	hsa-miR-219-5p	CLIP-seq
MIRT2120772	hsa-miR-3122	CLIP-seq
MIRT1402885	hsa-miR-3135	CLIP-seq
MIRT2120773	hsa-miR-3689a-3p	CLIP-seq
MIRT2120774	hsa-miR-3689c	CLIP-seq
MIRT2120775	hsa-miR-3909	CLIP-seq
MIRT2120776	hsa-miR-3913-5p	CLIP-seq
MIRT2120777	hsa-miR-4252	CLIP-seq
MIRT2120778	hsa-miR-4445	CLIP-seq
MIRT2120779	hsa-miR-4691-5p	CLIP-seq
MIRT2120780	hsa-miR-4728-5p	CLIP-seq
MIRT2120781	hsa-miR-4782-3p	CLIP-seq
MIRT1402894	hsa-miR-4797-5p	CLIP-seq
MIRT2120782	hsa-miR-508-3p	CLIP-seq
MIRT1402898	hsa-miR-759	CLIP-seq
MIRT2120783	hsa-miR-766	CLIP-seq
MIRT2342797	hsa-miR-1225-3p	CLIP-seq
MIRT2120770	hsa-miR-1227	CLIP-seq
MIRT2342798	hsa-miR-1233	CLIP-seq
MIRT2342799	hsa-miR-1273f	CLIP-seq
MIRT2342800	hsa-miR-143	CLIP-seq
MIRT2120771	hsa-miR-219-5p	CLIP-seq
MIRT2342801	hsa-miR-2467-5p	CLIP-seq
MIRT2120772	hsa-miR-3122	CLIP-seq
MIRT2342802	hsa-miR-3612	CLIP-seq
MIRT2120773	hsa-miR-3689a-3p	CLIP-seq
MIRT2120774	hsa-miR-3689c	CLIP-seq
MIRT2120776	hsa-miR-3913-5p	CLIP-seq
MIRT1402891	hsa-miR-3922-5p	CLIP-seq
MIRT2342803	hsa-miR-3929	CLIP-seq
MIRT2120777	hsa-miR-4252	CLIP-seq
MIRT2342804	hsa-miR-4419b	CLIP-seq
MIRT2342805	hsa-miR-4443	CLIP-seq
MIRT2120778	hsa-miR-4445	CLIP-seq
MIRT2342806	hsa-miR-4478	CLIP-seq
MIRT2342807	hsa-miR-4708-5p	CLIP-seq
MIRT2120780	hsa-miR-4728-5p	CLIP-seq
MIRT2342808	hsa-miR-4747-5p	CLIP-seq
MIRT2342809	hsa-miR-4770	CLIP-seq
MIRT2120781	hsa-miR-4782-3p	CLIP-seq
MIRT2342810	hsa-miR-4802-5p	CLIP-seq
MIRT2342811	hsa-miR-485-5p	CLIP-seq
MIRT2120782	hsa-miR-508-3p	CLIP-seq
MIRT2342812	hsa-miR-650	CLIP-seq
MIRT2342813	hsa-miR-890	CLIP-seq
MIRT2120772	hsa-miR-3122	CLIP-seq
MIRT2395423	hsa-miR-3137	CLIP-seq
MIRT2120773	hsa-miR-3689a-3p	CLIP-seq
MIRT2120774	hsa-miR-3689c	CLIP-seq
MIRT2120776	hsa-miR-3913-5p	CLIP-seq
MIRT2395424	hsa-miR-4540	CLIP-seq
MIRT2120780	hsa-miR-4728-5p	CLIP-seq
MIRT2342811	hsa-miR-485-5p	CLIP-seq
MIRT2395425	hsa-miR-654-3p	CLIP-seq
MIRT2342813	hsa-miR-890	CLIP-seq
MIRT2636667	hsa-miR-1283	CLIP-seq
MIRT2120772	hsa-miR-3122	CLIP-seq
MIRT2636668	hsa-miR-3613-3p	CLIP-seq
MIRT2636669	hsa-miR-3667-5p	CLIP-seq
MIRT2636670	hsa-miR-3675-3p	CLIP-seq
MIRT2120773	hsa-miR-3689a-3p	CLIP-seq
MIRT2120774	hsa-miR-3689c	CLIP-seq
MIRT2120776	hsa-miR-3913-5p	CLIP-seq
MIRT2636671	hsa-miR-4684-5p	CLIP-seq
MIRT2120780	hsa-miR-4728-5p	CLIP-seq
MIRT2120772	hsa-miR-3122	CLIP-seq
MIRT2120773	hsa-miR-3689a-3p	CLIP-seq
MIRT2120774	hsa-miR-3689c	CLIP-seq
MIRT2120776	hsa-miR-3913-5p	CLIP-seq
MIRT2120780	hsa-miR-4728-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
TFAP2A	Activation	17187826
TFAP2C	Activation	17187826

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004062	Function	Aryl sulfotransferase activity	IBA
GO:0004304	Function	Estrone sulfotransferase activity	IEA
GO:0004304	Function	Estrone sulfotransferase activity	TAS	8185618
GO:0005496	Function	Steroid binding	IEA
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006068	Process	Ethanol catabolic process	IDA	23207770
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006711	Process	Estrogen catabolic process	IDA	23207770
GO:0008146	Function	Sulfotransferase activity	IDA	19548878
GO:0008146	Function	Sulfotransferase activity	IEA
GO:0008202	Process	Steroid metabolic process	TAS	8185618
GO:0008210	Process	Estrogen metabolic process	IDA	11884392
GO:0008289	Function	Lipid binding	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0045600	Process	Positive regulation of fat cell differentiation	IMP	24567372
GO:0047894	Function	Flavonol 3-sulfotransferase activity	IDA	20056724
GO:0050294	Function	Steroid sulfotransferase activity	IDA	11884392, 23207770
GO:0050427	Process	3'-phosphoadenosine 5'-phosphosulfate metabolic process	IDA	23207770
GO:0051923	Process	Sulfation	IBA
GO:0051923	Process	Sulfation	IDA	19548878
GO:0051923	Process	Sulfation	IDA	20056724, 23207770

Other IDs

• MIM: 600043
• HGNC: 11377
• e!Ensembl: ENSG00000109193

Protein

• UniProt ID: P49888
• Protein name: Sulfotransferase 1E1 (ST1E1) (EC 2.8.2.4) (EST-1) (Estrogen sulfotransferase) (Sulfotransferase, estrogen-preferring)
• Protein function: Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of estradiol and estrone (PubMed:11006110, PubMed:11884392, PubMed:7779757). Is a key enzyme in estrogen homeostasis, the
• PDB: 1G3M, 1HY3, 4JVL, 4JVM, 4JVN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00685	Sulfotransfer_1	37 → 287	Sulfotransferase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Liver, intestine and at lower level in the kidney.
• Sequence:

  MNSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMI
  YKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEK
  DCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWE
  KGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYT
  TLPDEIMNQKLSPFMRKGITGDWKNHFTVALNEKFDKHYEQQMKESTLKFRTEI

• Sequence length: 294

Pathways

KEGG:

Steroid hormone biosynthesis
Metabolic pathways

Reactome:

Cytosolic sulfonation of small molecules

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHONDROMALACIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATITIS, ALCOHOLIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER DISEASES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	15015574		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	14659882		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	11172594		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	11279269		★☆☆☆☆ Found in Text Mining only
Androgen-Insensitivity Syndrome	Androgen-Insensitivity Syndrome	BEFREE	28117261, 30377893		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	29128888		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	30014361		★☆☆☆☆ Found in Text Mining only
Aortic Diseases	Aortic Diseases	BEFREE	31834032		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	14507642	Associate	★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	9790756		★☆☆☆☆ Found in Text Mining only
Bedwetting	Nocturnal enuresis	BEFREE	9605876		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	17187396		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	11172594		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12782580, 15647832, 15894657, 16541422, 18821033, 19250194, 25937633, 29581787, 30315444, 9749835		★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	20682005	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17661084, 19308726, 21720030	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28634336	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	17661084, 20682005	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	12818433		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22073269		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25817828	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	18821033, 25817828, 28588698		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	31440827		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	26943913, 28315942, 31680221		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	30014361		★☆☆☆☆ Found in Text Mining only
Cat eye syndrome	Cat Eye Syndrome	BEFREE	11381032		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	23112845	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27885496		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	14659882		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	11172594		★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	29533266		★☆☆☆☆ Found in Text Mining only
Choledocholithiasis	Choledocholithiasis	BEFREE	28668286		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	29533266		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	BEFREE	29929982		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	9790756		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	26705104	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15015574, 16772034, 23370358		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	23370358	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19446020		★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	18947387		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	29928010		★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary Aneurysm	BEFREE	31742786		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28455633, 28836949, 29128888, 30515893		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28608149		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	28455633, 30338825		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	18817817, 18831980, 19429440, 30822161		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	18817817	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	27220780, 30338825, 31770667		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33083497	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29981180		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28936576, 29224107, 30822161, 31174469, 31206765		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	9740669		★☆☆☆☆ Found in Text Mining only
Disorder of eye	Disorder Of Eye	BEFREE	9615227		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	30322052		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	14556660, 15355916, 16985250, 18318428, 21787115, 27923582, 29581787, 30217785		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	18467089		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	15355916, 18318428		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	18318428	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	38412094	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	17921479, 25767055, 26723541, 30965114		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	24824130	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25817828, 28588698		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	9763673		★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28797077		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	16552434		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	10873381		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	28471536		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	29928010		★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	30255609		★☆☆☆☆ Found in Text Mining only
Hereditary Multiple Exostoses	Multiple congenital exostosis	BEFREE	10878610		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	26422515		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28797077		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	31159858		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29150155, 29864203, 31037475		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	28768478		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29322374		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	17410442		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	9299237		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	23112845, 31205200		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15060005		★☆☆☆☆ Found in Text Mining only
Laryngeal neoplasm	Laryngeal neoplasm	BEFREE	19212623		★☆☆☆☆ Found in Text Mining only
Left ventricular systolic dysfunction	Ventricular Systolic Dysfunction	BEFREE	30653100		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	14576465		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	23775849	Inhibit	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	14576465		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23653380	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	28353310		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15647832, 15894657, 16541422, 18821033, 19250194, 25937633, 29581787, 30315444, 9749835		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16985250, 18318428, 21787115, 30217785		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22073269		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	18821033		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	16541422, 17437806, 19396154, 19893039, 27150425		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12736707, 12851705, 15770218		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10933042, 11472063, 11707285, 15015574, 16103744, 16541422, 16772034, 17192196, 17452638, 17584784, 18474104, 20813049, 25084127, 25817828, 28883432, 30822161		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15015574, 16772034		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	11376935, 11948410, 16043716		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15894657, 17661084		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	BEFREE	25901601		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	14659882		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	27220780, 30338825, 31770667		★☆☆☆☆ Found in Text Mining only
Mental Retardation	Mental retardation	BEFREE	9299237		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29224107		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21543429		★☆☆☆☆ Found in Text Mining only
Mitochondrial Respiratory Chain Deficiencies	Mitochondrial Respiratory Chain Deficiencies	BEFREE	10767177		★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	27502294		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	9205112		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	31056411		★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	19212623		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10092127, 10545798, 11264177, 12782580, 14586399, 14684992, 14719106, 15741768, 15885497, 16166425, 16552434, 16772034, 18474104, 19250194, 20813049, 25937633, 29581787, 9790756		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31206765		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	LHGDN	17661084		★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	8530067		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21543429		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21543429	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	23922954		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	11172594		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	15305059		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	18821033, 9737786		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32590918	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23653380, 30710069	Associate	★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	29609808		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	31718197		★☆☆☆☆ Found in Text Mining only
Peroxisome biogenesis disorders	Zellweger Syndrome	BEFREE	11405337		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	18467089		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	30802529	Stimulate	★☆☆☆☆ Found in Text Mining only
Primary Hyperoxaluria	Hyperoxaluria	BEFREE	31440827		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	26542807	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	16541422, 17437806, 19396154, 19893039, 27150425		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	11254220		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal Diseases	Retinal Diseases	BEFREE	10331942		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12082567, 14966480, 15861775		★☆☆☆☆ Found in Text Mining only
SCHIZOPHRENIA 1 (disorder)	Schizophrenia	BEFREE	12808430		★☆☆☆☆ Found in Text Mining only
Senile cardiac amyloidosis	Senile Cardiac Amyloidosis	BEFREE	27639764		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	26259151		★☆☆☆☆ Found in Text Mining only
Severe Acute Respiratory Syndrome	Severe Acute Respiratory Syndrome	BEFREE	21328370		★☆☆☆☆ Found in Text Mining only
Severe autosomal recessive muscular dystrophy of childhood - North African type (disorder)	Muscular dystrophy	BEFREE	8530067		★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	9740669		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	8242620		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	31056411, 31770667		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12736707, 12851705, 15770218		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	29322374		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	27878628, 31755582		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	16166425		★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	31205200		★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	24824130	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28888763		★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	11172594		★☆☆☆☆ Found in Text Mining only