STAT6 (signal transducer and activator of transcription 6)

Gene

• Entrez ID: 6778
• Gene name: Signal transducer and activator of transcription 6
• Gene symbol: STAT6
• Synonyms (NCBI Gene): D12S1644, HIES6, IL-4-STAT, STAT6B, STAT6C
• Chromosome: 12
• Chromosome location: 12q13.3
• Summary: The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that tran

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017016	hsa-miR-335-5p	Microarray	18185580
MIRT028991	hsa-miR-26b-5p	Microarray	19088304
MIRT052974	hsa-miR-135a-5p	Luciferase reporter assay, qRT-PCR, Western blot	22139076
MIRT437351	hsa-miR-361-5p	Luciferase reporter assay, qRT-PCR, Western blot	24491557
MIRT439116	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439116	hsa-miR-10b-5p	3'LIFE	25074381
MIRT731369	hsa-miR-135b-5p	Luciferase reporter assay	26870245
MIRT731369	hsa-miR-135b-5p	Luciferase reporter assay	26870245
MIRT052974	hsa-miR-135a-5p	Western blot	27293991
MIRT734568	hsa-miR-210-3p	Immunohistochemistry (IHC), qRT-PCR, Flow cytometry	31773789
MIRT052974	hsa-miR-135a-5p	Luciferase reporter assay, Western blotting, qRT-PCR	35702088
MIRT756389	hsa-miR-135a-3p	Luciferase reporter assay, qRT-PCR	35980503
MIRT1396063	hsa-miR-1238	CLIP-seq
MIRT1396064	hsa-miR-3176	CLIP-seq
MIRT1396065	hsa-miR-3614-5p	CLIP-seq
MIRT1396066	hsa-miR-3922-3p	CLIP-seq
MIRT1396067	hsa-miR-4280	CLIP-seq
MIRT1396068	hsa-miR-4433	CLIP-seq
MIRT1396069	hsa-miR-4535	CLIP-seq
MIRT1396070	hsa-miR-4691-5p	CLIP-seq
MIRT1396071	hsa-miR-4711-3p	CLIP-seq
MIRT1396072	hsa-miR-4757-5p	CLIP-seq
MIRT1396073	hsa-miR-4776-5p	CLIP-seq
MIRT1396074	hsa-miR-635	CLIP-seq
MIRT1396075	hsa-miR-665	CLIP-seq
MIRT1396076	hsa-miR-711	CLIP-seq
MIRT1396077	hsa-miR-890	CLIP-seq
MIRT1396078	hsa-miR-153	CLIP-seq
MIRT1396079	hsa-miR-4474-5p	CLIP-seq
MIRT1396080	hsa-miR-448	CLIP-seq
MIRT1396081	hsa-miR-450b-5p	CLIP-seq
MIRT1396082	hsa-miR-4643	CLIP-seq
MIRT1396083	hsa-miR-485-3p	CLIP-seq
MIRT1396084	hsa-miR-507	CLIP-seq
MIRT1396085	hsa-miR-557	CLIP-seq
MIRT1396086	hsa-miR-642b	CLIP-seq
MIRT1396063	hsa-miR-1238	CLIP-seq
MIRT2118770	hsa-miR-1912	CLIP-seq
MIRT2118771	hsa-miR-1976	CLIP-seq
MIRT2118772	hsa-miR-198	CLIP-seq
MIRT2118773	hsa-miR-2115	CLIP-seq
MIRT2118774	hsa-miR-2278	CLIP-seq
MIRT2118775	hsa-miR-3130-5p	CLIP-seq
MIRT2118776	hsa-miR-3145-5p	CLIP-seq
MIRT2118777	hsa-miR-3151	CLIP-seq
MIRT2118778	hsa-miR-3160-3p	CLIP-seq
MIRT1396065	hsa-miR-3614-5p	CLIP-seq
MIRT2118779	hsa-miR-370	CLIP-seq
MIRT2118780	hsa-miR-3943	CLIP-seq
MIRT2118781	hsa-miR-411	CLIP-seq
MIRT1396068	hsa-miR-4433	CLIP-seq
MIRT2118782	hsa-miR-4447	CLIP-seq
MIRT2118783	hsa-miR-4472	CLIP-seq
MIRT2118784	hsa-miR-4482	CLIP-seq
MIRT2118785	hsa-miR-4487	CLIP-seq
MIRT2118786	hsa-miR-4494	CLIP-seq
MIRT1396069	hsa-miR-4535	CLIP-seq
MIRT2118787	hsa-miR-4667-3p	CLIP-seq
MIRT2118788	hsa-miR-4690-3p	CLIP-seq
MIRT1396070	hsa-miR-4691-5p	CLIP-seq
MIRT1396071	hsa-miR-4711-3p	CLIP-seq
MIRT1396073	hsa-miR-4776-5p	CLIP-seq
MIRT2118789	hsa-miR-4780	CLIP-seq
MIRT1396083	hsa-miR-485-3p	CLIP-seq
MIRT2118790	hsa-miR-491-5p	CLIP-seq
MIRT2118791	hsa-miR-499a-5p	CLIP-seq
MIRT2118792	hsa-miR-516a-3p	CLIP-seq
MIRT2118793	hsa-miR-558	CLIP-seq
MIRT2118794	hsa-miR-623	CLIP-seq
MIRT1396074	hsa-miR-635	CLIP-seq
MIRT1396075	hsa-miR-665	CLIP-seq
MIRT1396076	hsa-miR-711	CLIP-seq
MIRT2118795	hsa-miR-767-3p	CLIP-seq
MIRT1396077	hsa-miR-890	CLIP-seq
MIRT2634891	hsa-miR-103a	CLIP-seq
MIRT2634892	hsa-miR-107	CLIP-seq
MIRT2634893	hsa-miR-1202	CLIP-seq
MIRT2634894	hsa-miR-1229	CLIP-seq
MIRT2634895	hsa-miR-1277	CLIP-seq
MIRT2634896	hsa-miR-1284	CLIP-seq
MIRT2634897	hsa-miR-149	CLIP-seq
MIRT2634898	hsa-miR-150	CLIP-seq
MIRT2634899	hsa-miR-188-5p	CLIP-seq
MIRT2634900	hsa-miR-18a	CLIP-seq
MIRT2634901	hsa-miR-18b	CLIP-seq
MIRT2634902	hsa-miR-1915	CLIP-seq
MIRT2118771	hsa-miR-1976	CLIP-seq
MIRT2634903	hsa-miR-299-3p	CLIP-seq
MIRT1396064	hsa-miR-3176	CLIP-seq
MIRT2634904	hsa-miR-3189-5p	CLIP-seq
MIRT2634905	hsa-miR-3194-5p	CLIP-seq
MIRT2634906	hsa-miR-3620	CLIP-seq
MIRT2634907	hsa-miR-3689d	CLIP-seq
MIRT2118779	hsa-miR-370	CLIP-seq
MIRT2634908	hsa-miR-3911	CLIP-seq
MIRT1396066	hsa-miR-3922-3p	CLIP-seq
MIRT2118780	hsa-miR-3943	CLIP-seq
MIRT2634909	hsa-miR-3972	CLIP-seq
MIRT2634910	hsa-miR-4266	CLIP-seq
MIRT2634911	hsa-miR-4292	CLIP-seq
MIRT2634912	hsa-miR-4308	CLIP-seq
MIRT2634913	hsa-miR-4310	CLIP-seq
MIRT2634914	hsa-miR-4323	CLIP-seq
MIRT1396068	hsa-miR-4433	CLIP-seq
MIRT2634915	hsa-miR-4443	CLIP-seq
MIRT2634916	hsa-miR-4450	CLIP-seq
MIRT2634917	hsa-miR-4491	CLIP-seq
MIRT2634918	hsa-miR-4514	CLIP-seq
MIRT1396082	hsa-miR-4643	CLIP-seq
MIRT2634919	hsa-miR-4645-5p	CLIP-seq
MIRT2634920	hsa-miR-4657	CLIP-seq
MIRT2118787	hsa-miR-4667-3p	CLIP-seq
MIRT2634921	hsa-miR-4673	CLIP-seq
MIRT2118788	hsa-miR-4690-3p	CLIP-seq
MIRT2634922	hsa-miR-4692	CLIP-seq
MIRT2634923	hsa-miR-4695-5p	CLIP-seq
MIRT2634924	hsa-miR-4726-3p	CLIP-seq
MIRT2634925	hsa-miR-4735-3p	CLIP-seq
MIRT2634926	hsa-miR-4779	CLIP-seq
MIRT2634927	hsa-miR-4786-5p	CLIP-seq
MIRT2118790	hsa-miR-491-5p	CLIP-seq
MIRT2634928	hsa-miR-576-3p	CLIP-seq
MIRT2634929	hsa-miR-599	CLIP-seq
MIRT1396086	hsa-miR-642b	CLIP-seq
MIRT1396075	hsa-miR-665	CLIP-seq
MIRT2118795	hsa-miR-767-3p	CLIP-seq
MIRT2634930	hsa-miR-769-5p	CLIP-seq
MIRT2634931	hsa-miR-891b	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
HDAC9	Repression	21106524
SFPQ	Repression	21106524

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	8810328
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	36884218
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001223	Function	Transcription coactivator binding	EXP	29203888
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	8810328
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0002296	Process	T-helper 1 cell lineage commitment	IEA
GO:0002829	Process	Negative regulation of type 2 immune response	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	8816495
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	TAS	10747856
GO:0005515	Function	Protein binding	IPI	8816495, 9392697, 9651359, 9989503, 20211142, 22000020, 23461825
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	7694370
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	36758835
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006952	Process	Defense response	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IBA
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	IMP	12574355
GO:0007259	Process	Cell surface receptor signaling pathway via JAK-STAT	NAS	22000020, 24058793
GO:0010467	Process	Gene expression	IEA
GO:0019221	Process	Cytokine-mediated signaling pathway	IBA
GO:0019221	Process	Cytokine-mediated signaling pathway	IMP	36884218
GO:0019903	Function	Protein phosphatase binding	IPI	17210636
GO:0033598	Process	Mammary gland epithelial cell proliferation	IEA
GO:0035771	Process	Interleukin-4-mediated signaling pathway	IDA	7760829
GO:0035771	Process	Interleukin-4-mediated signaling pathway	IEA
GO:0035771	Process	Interleukin-4-mediated signaling pathway	IMP	12574355, 17210636, 36758835
GO:0042127	Process	Regulation of cell population proliferation	IBA
GO:0042802	Function	Identical protein binding	IPI	22000020
GO:0043434	Process	Response to peptide hormone	IBA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	8810328
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	12574355
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	NAS	22000020, 24058793
GO:0048289	Process	Isotype switching to IgE isotypes	IEA
GO:0048295	Process	Positive regulation of isotype switching to IgE isotypes	IEA
GO:0060397	Process	Growth hormone receptor signaling pathway via JAK-STAT	IBA
GO:0060443	Process	Mammary gland morphogenesis	IEA
GO:0070666	Process	Regulation of mast cell proliferation	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IPI	22000020
GO:0090575	Component	RNA polymerase II transcription regulator complex	NAS	24058793
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	IEA
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24906148

Other IDs

• MIM: 601512
• HGNC: 11368
• e!Ensembl: ENSG00000166888

Protein

• UniProt ID: P42226
• Protein name: Signal transducer and activator of transcription 6 (IL-4 Stat)
• Protein function: Carries out a dual function: signal transduction and activation of transcription. Involved in IL4/interleukin-4- and IL3/interleukin-3-mediated signaling.
• PDB: 1OJ5, 4Y5U, 4Y5W, 5D39, 5NWM, 5NWX, 9BIG
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02865	STAT_int	2 → 114	STAT protein, protein interaction domain	Domain
  PF01017	STAT_alpha	161 → 268	STAT protein, all-alpha domain	Family
  PF02864	STAT_bind	277 → 413	STAT protein, DNA binding domain	Domain
  PF00017	SH2	537 → 616	SH2 domain	Domain
  PF14596	STAT6_C	655 → 847	STAT6 C-terminal	Family

• Sequence:

  MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDT
  VQHLQASVGEQGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMP
  FHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALA
  MLLQETTGELEAAKALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLVDIYSQLQQ
  EVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPPQVLKTQTKFQAGVRFLLGLR
  FLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENSIPGNCCSALF
  KNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN
  NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQK
  IFNDNSLSMEAFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIG
  FISKQYVTSLLLNEPDGTFLLRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIR
  SLGDRIRDLAQLKNLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPE
  LQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSIPPYQGLSPEESVNVLSAFQE
  PHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAF
  PQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMD
  LRANPSW

• Sequence length: 847

Pathways

KEGG:

Necroptosis
JAK-STAT signaling pathway
Th1 and Th2 cell differentiation
Th17 cell differentiation
Hepatitis B
Pathways in cancer
Inflammatory bowel disease

Reactome:

Downstream signal transduction
STAT6-mediated induction of chemokines
Interleukin-4 and Interleukin-13 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Hyper-IgE syndrome 6, autosomal dominant, with recurrent infections	Pathogenic; Likely pathogenic	rs2548025666, rs11172102, rs2548028819, rs2548019791, rs2548028861	RCV003333716 RCV003333717 RCV003333718 RCV003333719 RCV003333720 RCV003333721	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Neoplasm	Likely pathogenic	rs11172102	RCV004673874	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ONSET ASTHMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATITIS, ATOPIC	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EOSINOPHILIC ESOPHAGITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY SYSTEM DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URTICARIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	LHGDN	14634100		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	31075146		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31497205, 31798581		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	28654863		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	11781246, 17652621, 21418178, 26811457, 31822802		★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	20608912, 29752758, 30665041		★☆☆☆☆ Found in Text Mining only
Allergic sensitization	Allergic Sensitization	GWASDB_DG	23817571		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	26699812		★☆☆☆☆ Found in Text Mining only
Anaphylaxis	Anaphylaxis	Pubtator	36884218, 37316763	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30010060		★☆☆☆☆ Found in Text Mining only
Angiofibroma	Angiofibroma	BEFREE	24856853		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	19333939		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	16169330, 28650342		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12218156		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	Pubtator	16096332	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Juvenile	Juvenile arthritis	Pubtator	29928998	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16096332, 16760256, 17223651, 27629845	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	10353570, 11069563, 11207314, 11692112, 11839568, 11912176, 14735150, 14767694, 15105161, 15637551, 15677460, 16364194, 17519224, 17532201, 17919711, 18502398, 19175798, 19388947, 19494273, 19796199, 19949830, 20394509, 20961336, 21205293, 21276008, 21749458, 21814192, 22017802, 22355322, 22365404, 22867713, 23402658, 23861779, 24150243, 24912007, 24952213, 25299150, 26932604, 28093225, 28510479, 28974953, 29288730, 29499930, 29680833, 29739850, 30209189, 30380514, 30511616		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	LHGDN	11912176		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	15342695, 17532201, 19175798, 20093796, 22162773, 22365404, 22660217, 23402658, 26466682, 32900903, 35140898, 37316763, 39423878, 40375219, 9768594	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	26781462	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	GWASCAT_DG	27182965, 29273806, 29785011, 30552067, 30787307, 30929738, 31619474		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	BEFREE	21595984		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	21595984	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	16169330, 28650342		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	22162773	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	16844317		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	22867713, 25407941, 26031516		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	25407941, 26031516	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	15044251, 17210636		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	19423726, 24491557, 26461141, 29501729, 30338340		★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary Atresia	BEFREE	22005305		★☆☆☆☆ Found in Text Mining only
Bloch Sulzberger syndrome	Incontinentia pigmenti syndrome	BEFREE	27566834, 30427538		★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	31619589		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18342537, 23184467, 23562473, 24401087, 25104439, 26208975, 28235236, 29066614, 31075146, 9892013		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12082548, 23562473, 25104439, 28235236, 28422733, 31075146, 32525891, 32580398, 32883354, 34572592, 35906698, 35999655	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24401087	Inhibit	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	20393449		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	20393449, 21828071	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Head	Neoplasm of head	CTD_human_DG	21765211		★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	21765211		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30105735	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11912448		★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	35906698	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30105735	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31485610, 33006365	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	30105735	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10419177, 31430374, 31798581		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	20339477, 23935100, 24885059	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32640276	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28972958, 30105735	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	39245357	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	31323143		★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	15247173		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31619589		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	25127987		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	25127987		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	20716621, 29656114		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	BEFREE	22365404		★☆☆☆☆ Found in Text Mining only
Childhood asthma	Asthma	GWASCAT_DG	30929738, 31036433		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	40536380	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	12921752		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	20716767, 24966942, 27002119, 31289477		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19796199, 21814192, 31679431		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	23303670, 23562811, 26601901, 29304229, 30353167, 31534167		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	20014020, 21308881, 22467146, 23154639, 28752100	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	16387423, 18536936, 19551406, 22121102, 28385737, 28654863		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	16387423, 18536936		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	20014020	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22121102, 27783989, 29901191, 31534167, 31718693		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20480530, 22121102, 27533463, 31075146, 31718693	Associate	★☆☆☆☆ Found in Text Mining only
Congenital atresia of extrahepatic bile duct	Extrahepatic Biliary Atresia	BEFREE	22005305		★☆☆☆☆ Found in Text Mining only
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	30819530		★☆☆☆☆ Found in Text Mining only
Conjunctivitis	Conjunctivitis	BEFREE	21749458		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23935100		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	14571275, 15888279, 21308881		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	15528258, 15888279		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	22467146	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	29915289		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	19398961	Associate	★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	29596844	Stimulate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	29587269		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	32438399	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	20147633, 24742632, 27510401, 28653395		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	37316763	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	12151598, 12759487, 16681592, 21749458, 21762972, 22226123, 24742632, 26048407, 27018548, 27813070, 29368135, 29649105		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	CTD_human_DG	15306842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatitis, Atopic	Dermatitis	LHGDN	17371990		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatologic disorders	Dermatologic Disorders	BEFREE	16877367, 24726501		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	27803134	Associate	★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	25873501	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24204704, 30338340	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30338340		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	15044251, 15591113, 17210636		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	12151598, 12759487, 16681592, 21762972, 22226123, 23815671, 24742632, 26048407, 27018548, 27813070, 29368135, 29649105		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	23815671	Associate	★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Eczema, Infantile	Eczema	CTD_human_DG	15306842		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	35244291	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	17213269, 31727934		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	17213269		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	BEFREE	11912176, 23689305, 27566834, 30910757, 31490856		★☆☆☆☆ Found in Text Mining only
Eosinophilia	Eosinophilia	Pubtator	36884218	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	21694534, 23185525, 23689305, 25407941, 27310888, 30578870, 31490856		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic Esophagitis	Eosinophilia	Pubtator	21694534	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic Esophagitis	Eosinophilia	Pubtator	23185525, 25407941, 27310888, 30626591, 31490856, 32798708, 35126392	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Eosinophilic esophagitis	Eosinophilia	GWASCAT_DG	25407941		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
fibroma	Fibroma	BEFREE	29940288		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	29228868		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	40536380	Stimulate	★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	22524533	Inhibit	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	36884218	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	21196282, 21595984, 26817999, 31530290		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21196282, 21595984, 26817999, 33104022	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31530290	Inhibit	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15805299, 21196282, 21595984, 26817999, 31530290		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	21196282, 21595984, 30839135		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	21196282, 31530290	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	12921752		★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30266770		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	17362266		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	17362266	Associate	★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	32615729	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	21765211		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	24192080, 35303277	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head Neoplasms	Head Neoplasms	CTD_human_DG	21765211		★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	ORPHANET_DG	23313952, 23313954		★☆☆☆☆ Found in Text Mining only
hemangiopericytoma	Hemangiopericytoma	BEFREE	25893823, 26746203, 26883114, 27271270, 28128724, 28295484, 29600523, 30233017, 30716501		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	35999655	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	23575898, 25893823, 26746203, 27271270, 28295484, 29600523, 30233017, 30864263		★☆☆☆☆ Found in Text Mining only
Histiocytoma, Angiomatoid Fibrous	Histiocytoma	BEFREE	30819530		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	11781246, 17652621, 20876453, 21418178, 26811457, 31822802		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	11781246, 16954503, 17606441, 17652621, 18541724, 21418178, 29449275, 29650799, 31816062, 32079702	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	LHGDN	17606441, 17652621		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	21418178	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	10747856, 15342695, 17362266, 36884218, 37316763	Associate	★☆☆☆☆ Found in Text Mining only
Hyperthyroidism	Hyperthyroidism	BEFREE	16195404		★☆☆☆☆ Found in Text Mining only
Hypoinsulinaemia (disorder)	Hypoinsulinemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets	Hypophosphatemic Rickets	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	31530290	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30229666		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	30132546		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12605697, 15888279, 19230040, 26601901, 31534167		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	12605697, 19230040	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	15522309, 16084752		★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	29485045		★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	20147633, 27510401		★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	30382607, 30819530		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	19520737	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	28654863		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	26601901		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	26246572, 28099521, 30532138		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	12921752		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	30642265	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	20438785	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23474756	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28819278		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	24457460, 40540926	Associate	★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	28749793		★☆☆☆☆ Found in Text Mining only
Liposarcoma Myxoid	Liposarcoma	Pubtator	40540926	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	24457460, 24702701, 30382607		★☆☆☆☆ Found in Text Mining only
Liposarcoma, well differentiated	liposarcoma	BEFREE	28749793		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28525794, 31408278, 31485610		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	40536380	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	17237818		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22162773	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	33763079	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20530519		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20480530	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15044251, 21418178, 25428220, 31075146		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	16418334, 21418178, 25428220, 26246572, 31075146, 37316763	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	18682601, 20944673, 23297127, 25428220, 29193015, 32555149, 33211828, 34957565, 35363872, 35816682, 35851155, 37316763, 37493986, 37561599	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	25428220, 26965583		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	11781246		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	25485578, 25486484		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	21765211		★☆☆☆☆ Found in Text Mining only
Malignant Meningioma	Malignant Meningioma	BEFREE	23860521		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18342537, 23184467, 23562473, 24401087, 25104439, 26208975, 28235236, 29066614, 31075146, 9892013		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31430374, 31798581		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11912448, 17705178, 20121258, 24491557, 28553931, 30675252		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30944204		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17705178, 22108090, 28385737, 28525794, 28914981, 29771943, 31075146, 31530290, 31534167		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	25127987		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	16387423, 18536936, 19551406, 22121102, 28385737, 28654863		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31679431		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12082548, 18342537		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	15044251		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26993600		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23575898, 26514459		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	23860521	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29587269		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	29587269		★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	30675252		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	37592229	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	35718799	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	31568628	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18209728, 29126764		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	18209728, 19398961	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	32438399	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	30338340		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30854870		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	16169330		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	37385124	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	21765211		★☆☆☆☆ Found in Text Mining only
Neoplasia of the pleura	Neoplasia of the pleura	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11912448, 14593499, 17210636, 17705178, 21536546, 22108090, 23313952, 23575898, 24513261, 24856853, 25667482, 26022454, 26845637, 26883114, 26993600, 27292373, 27440511, 27802414, 28385737, 28443588, 28494796, 28587956, 28869107, 29066614, 29106748, 29257041, 29650799, 30233017, 30353167, 30532138, 30554000, 30584643, 30664532, 30670595, 30819530, 30957324, 30975087, 31321477, 31529158, 31530290, 31798581		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	22252769	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	12900808, 15687724, 19011907		★☆☆☆☆ Found in Text Mining only
Nervous System Neoplasms	Nervous System Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31408278		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17237818, 26461141, 27072223, 30105735, 31497205		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	28064224	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28536310	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36335356	Associate	★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	32926429	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	25922073		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	29513071		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	16418334		★☆☆☆☆ Found in Text Mining only
Prostate cancer familial	Prostate cancer	Pubtator	30183767, 30693881	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11912448, 17705178, 20121258, 24491557, 28553931, 30675252		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	17705178		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17705178		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20025723, 38087324	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	29757188		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31679431	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Emphysema	Pulmonary Emphysema	BEFREE	30209189		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	26699812		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28687632, 29510393		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	35964659	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22121102		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23935100		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	GWASCAT_DG	30595370		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	21536546		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10725752, 19949830		★☆☆☆☆ Found in Text Mining only
Rhinitis	Rhinitis	BEFREE	21749458, 22017802		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	24702701		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35238118	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	28099521	Associate	★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28749793		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	28365359		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	32438399	Stimulate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	26031516	Associate	★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	31323143		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	16877367, 22992805	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	12151598		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	BEFREE	23313952, 23313954, 23575898, 23761323, 24434011, 24457460, 24513261, 24702701, 24807787, 24856853, 25482924, 25554652, 25582503, 25667482, 25893823, 26022454, 26154686, 26226844, 26337721, 26686340, 26746203, 26811225, 26817999, 26883114, 27039712, 27271270, 27292373, 28128724, 28295484, 28494796, 28683839, 28749793, 28869107, 28914981, 28968297, 29106748, 29228868, 29257041, 29309807, 29310366, 29600523, 30072169, 30233017, 30431144, 30664532, 30819530, 30864263, 31321477, 31424136, 31463729, 31498908		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	ORPHANET_DG	23313952, 23313954		★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	CTD_human_DG	23313952, 23313954		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30105735, 31798581		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24192080	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30944204		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30944204	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	28869107		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	28365359		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	31822802		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32615729	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37561599	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	12605697, 17074026, 21308881, 22851040, 23303670, 28752100		★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	21765211		★☆☆☆☆ Found in Text Mining only
Urogenital Neoplasms	Urogenital neoplasm	Pubtator	27802414	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	25127987	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Endometrial Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vaginal Neoplasms	Vaginal Neoplasms	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	28129744	Associate	★☆☆☆☆ Found in Text Mining only