SSTR5 (somatostatin receptor 5)

Gene

• Entrez ID: 6755
• Gene name: Somatostatin receptor 5
• Gene symbol: SSTR5
• Synonyms (NCBI Gene): SS-5-R, SST5
• Chromosome: 16
• Chromosome location: 16p13.3
• Summary: Somatostatin and its related peptide cortistatin exert multiple biological actions on normal and tumoral tissue targets by interacting with somatostatin receptors (SSTRs). The protein encoded by this gene is one of the SSTRs, which is a multi-pass membran

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1392875	hsa-let-7a	CLIP-seq
MIRT1392876	hsa-let-7b	CLIP-seq
MIRT1392877	hsa-let-7c	CLIP-seq
MIRT1392878	hsa-let-7d	CLIP-seq
MIRT1392879	hsa-let-7e	CLIP-seq
MIRT1392880	hsa-let-7f	CLIP-seq
MIRT1392881	hsa-let-7g	CLIP-seq
MIRT1392882	hsa-let-7i	CLIP-seq
MIRT1392883	hsa-miR-1197	CLIP-seq
MIRT1392884	hsa-miR-125a-5p	CLIP-seq
MIRT1392885	hsa-miR-125b	CLIP-seq
MIRT1392886	hsa-miR-1275	CLIP-seq
MIRT1392887	hsa-miR-2467-3p	CLIP-seq
MIRT1392888	hsa-miR-3170	CLIP-seq
MIRT1392889	hsa-miR-342-5p	CLIP-seq
MIRT1392890	hsa-miR-4260	CLIP-seq
MIRT1392891	hsa-miR-4319	CLIP-seq
MIRT1392892	hsa-miR-4447	CLIP-seq
MIRT1392893	hsa-miR-4458	CLIP-seq
MIRT1392894	hsa-miR-4472	CLIP-seq
MIRT1392895	hsa-miR-4500	CLIP-seq
MIRT1392896	hsa-miR-4525	CLIP-seq
MIRT1392897	hsa-miR-4649-3p	CLIP-seq
MIRT1392898	hsa-miR-4651	CLIP-seq
MIRT1392899	hsa-miR-4664-5p	CLIP-seq
MIRT1392900	hsa-miR-4665-5p	CLIP-seq
MIRT1392901	hsa-miR-4723-5p	CLIP-seq
MIRT1392902	hsa-miR-4732-3p	CLIP-seq
MIRT1392903	hsa-miR-544b	CLIP-seq
MIRT1392904	hsa-miR-608	CLIP-seq
MIRT1392905	hsa-miR-615-5p	CLIP-seq
MIRT1392906	hsa-miR-625	CLIP-seq
MIRT1392907	hsa-miR-670	CLIP-seq
MIRT1392908	hsa-miR-98	CLIP-seq
MIRT2117917	hsa-miR-1285	CLIP-seq
MIRT2117918	hsa-miR-3187-5p	CLIP-seq
MIRT2117919	hsa-miR-378g	CLIP-seq
MIRT2117920	hsa-miR-4486	CLIP-seq
MIRT2117921	hsa-miR-612	CLIP-seq
MIRT2339888	hsa-miR-1291	CLIP-seq
MIRT2339889	hsa-miR-214	CLIP-seq
MIRT2339890	hsa-miR-3144-5p	CLIP-seq
MIRT2339891	hsa-miR-3619-5p	CLIP-seq
MIRT2339892	hsa-miR-4435	CLIP-seq
MIRT2339893	hsa-miR-761	CLIP-seq
MIRT2460575	hsa-miR-3183	CLIP-seq
MIRT2460576	hsa-miR-3197	CLIP-seq
MIRT2460577	hsa-miR-339-5p	CLIP-seq
MIRT2460578	hsa-miR-3909	CLIP-seq
MIRT2460579	hsa-miR-4316	CLIP-seq
MIRT2460580	hsa-miR-4534	CLIP-seq
MIRT2460581	hsa-miR-4640-5p	CLIP-seq
MIRT2460582	hsa-miR-4710	CLIP-seq
MIRT2460583	hsa-miR-4723-3p	CLIP-seq
MIRT2460584	hsa-miR-4725-5p	CLIP-seq
MIRT2460585	hsa-miR-4726-5p	CLIP-seq
MIRT1392902	hsa-miR-4732-3p	CLIP-seq
MIRT2460586	hsa-miR-4802-5p	CLIP-seq
MIRT2460587	hsa-miR-504	CLIP-seq
MIRT2460588	hsa-miR-515-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004994	Function	Somatostatin receptor activity	IBA
GO:0004994	Function	Somatostatin receptor activity	IEA
GO:0004994	Function	Somatostatin receptor activity	TAS	9892014
GO:0005515	Function	Protein binding	IPI	15247250, 18653781, 19426801
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7908405
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	9892014
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	7908405
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9892014
GO:0016020	Component	Membrane	IEA
GO:0032467	Process	Positive regulation of cytokinesis	IMP	22888021
GO:0038170	Process	Somatostatin signaling pathway	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0050796	Process	Regulation of insulin secretion	IBA
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IBA

Other IDs

• MIM: 182455
• HGNC: 11334
• e!Ensembl: ENSG00000162009

Protein

• UniProt ID: P35346
• Protein name: Somatostatin receptor type 5 (SS-5-R) (SS5-R) (SS5R) (SST5)
• Protein function: Receptor for somatostatin 28 and to a lesser extent for somatostatin-14. The activity of this receptor is mediated by G proteins which inhibit adenylyl cyclase. Increases cell growth inhibition activity of SSTR2 following heterodimerization. {EC
• PDB: 8X8L, 8X8N, 8ZBE, 8ZCJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	57 → 304	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Adult pituitary gland, heart, small intestine, adrenal gland, cerebellum and fetal hypothalamus. No expression in fetal or adult kidney, liver, pancreas, uterus, spleen, lung, thyroid or ovary. {ECO:0000269|PubMed:12072395, ECO:0000269
• Sequence:

  MEPLFPASTPSWNASSPGAASGGGDNRTLVGPAPSAGARAVLVPVLYLLVCAAGLGGNTL
  VIYVVLRFAKMKTVTNIYILNLAVADVLYMLGLPFLATQNAASFWPFGPVLCRLVMTLDG
  VNQFTSVFCLTVMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADV
  QEGGTCNASWPEPVGLWGAVFIIYTAVLGFFAPLLVICLCYLLIVVKVRAAGVRVGCVRR
  RSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCAN
  PVLYGFLSDNFRQSFQKVLCLRKGSGAKDADATEPRPDRIRQQQEATPPAHRAAANGLMQ
  TSKL

• Sequence length: 364

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Growth hormone synthesis, secretion and action

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYCYSTIC OVARY SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SSTR5-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	15914528, 21744088, 21810856, 28396686, 30346538, 7521350		★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	21744088, 21810856, 28434012, 39201352	Associate	★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	15817922, 16625843, 28434012		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	20717067		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10690891, 11231991, 11264647, 15914528, 15994755, 17420609, 28434012, 31518993, 7521350, 8866248		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	7775631		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30415874		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	29685964	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	12898583		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	12192619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	12192619, 20398908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	25925002, 30476894		★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	11772967, 9484822	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	22156600		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	29282035, 31236404, 31638225	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	37540574	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	21503779		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	39519394	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29282035	Associate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16610049	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16610049	Associate	★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	18951627		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	20150960, 21383526	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28938487		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28822091, 28938487		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28642028, 28988629		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	29750706		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	31176519		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	36726845	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	35578166	Associate	★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	23991955	Associate	★☆☆☆☆ Found in Text Mining only
Gastrinoma	Gastrinoma	BEFREE	12021920		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	35163067	Associate	★☆☆☆☆ Found in Text Mining only
Glucagonoma	Glucagonoma	BEFREE	12021920, 8132773		★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	18951627		★☆☆☆☆ Found in Text Mining only
Growth Hormone Deficiency With Pituitary Anomalies	Growth hormone deficiency with pituitary anomalies	Pubtator	26391562	Associate	★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	12788890, 21744088, 23847328, 27455094, 31518993		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	33297556	Associate	★☆☆☆☆ Found in Text Mining only
Hyperaldosteronism	Hyperaldosteronism	Pubtator	34690553	Associate	★☆☆☆☆ Found in Text Mining only
Hyperpituitarism	Hyperpituitarism	Pubtator	17420609	Associate	★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	28397723, 28434012	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	LHGDN	14602773		★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	16601280, 22669743		★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	20717067, 22669743		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	18443363	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	31196171	Inhibit	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	31196171		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27391928		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	12192619		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	12192619		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	12192619		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	12192619		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	PSYGENET_DG	20398908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	25925002, 30476894		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	21503779		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15145694, 21249361, 21692047, 25890201		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19423539, 24211300, 9253335		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	17916997, 25890201, 31336364		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	12063634		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	26722517, 33899156	Associate	★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	28694195		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	LHGDN	12192619		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11231991, 16601280, 16625841, 17159301, 17420609, 19169483, 20385747, 20423238, 21692047, 21744088, 21810856, 22136833, 22156600, 24647046, 25008035, 25011056, 25765100, 28059098, 28396686, 28397723, 28454229, 29180250, 29282035, 29807052, 29948930, 30611770, 30657933, 7521350, 9062398		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	20423238, 22156600, 26673010, 28155055, 28454229		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	18951627		★☆☆☆☆ Found in Text Mining only
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	19318729		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15145694, 21249361, 21692047, 25890201		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	21692047		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21692047, 22136833, 25890201	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	22136833, 25890201	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26889637	Associate	★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	39519394	Associate	★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	18951627		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	7775631		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	28434012		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	16216913		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	20464704, 25536318, 34674191, 39202532	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	21744088	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	Pubtator	31176519	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney, Autosomal Dominant	Polycystic kidney disease	BEFREE	21744088		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	10487698, 18426817, 28434012, 7521350		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19423539, 24211300		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21151154, 23341348	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	33297556	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20398908		★☆☆☆☆ Found in Text Mining only
Secondary Adrenal Insufficiency	Adrenal Insufficiency	BEFREE	30282821		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	25494861		★☆☆☆☆ Found in Text Mining only
Spherocytosis Hereditary	Spherocytosis	Pubtator	33297556	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31196171	Inhibit	★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	18951627		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	18951627		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32495873	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	10768564, 24465589	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	23672766	Associate	★☆☆☆☆ Found in Text Mining only
Thyrotroph adenoma	Adenoma	BEFREE	28434012		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	PSYGENET_DG	20398908		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uveal Melanoma	BEFREE	29949880		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	29949880	Associate	★☆☆☆☆ Found in Text Mining only
Warburg Sjo Fledelius syndrome	Warburg micro syndrome	Pubtator	39202532	Associate	★☆☆☆☆ Found in Text Mining only