Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6752
Gene name	Somatostatin receptor 2
Gene symbol	SSTR2
Synonyms (NCBI Gene)	SST2
Chromosome	17
Chromosome location	17q25.1
Summary	Somatostatin acts at many sites to inhibit the release of many hormones and other secretory proteins. The biologic effects of somatostatin are probably mediated by a family of G protein-coupled receptors that are expressed in a tissue-specific manner. SST

219

Show/Hide all (219)

miRTarBase ID	miRNA	Experiments	Reference
MIRT666092	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT666091	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT666090	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT666089	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT666088	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT666087	hsa-miR-3666	HITS-CLIP	23824327
MIRT666086	hsa-miR-4295	HITS-CLIP	23824327
MIRT666085	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT666084	hsa-miR-183-5p	HITS-CLIP	23824327
MIRT666083	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT666082	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT666081	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT666080	hsa-miR-3135b	HITS-CLIP	23824327
MIRT666079	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT666078	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT666077	hsa-miR-564	HITS-CLIP	23824327
MIRT666076	hsa-miR-3652	HITS-CLIP	23824327
MIRT666075	hsa-miR-4430	HITS-CLIP	23824327
MIRT666074	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT647875	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT647874	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT647873	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT542172	hsa-miR-1273g-3p	PAR-CLIP	21572407
MIRT542171	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT542170	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT542169	hsa-miR-191-3p	PAR-CLIP	21572407
MIRT542168	hsa-miR-4252	PAR-CLIP	21572407
MIRT542167	hsa-miR-1227-3p	PAR-CLIP	21572407
MIRT542166	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT542165	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT517888	hsa-miR-3653-5p	PAR-CLIP	23446348
MIRT517887	hsa-miR-6790-3p	PAR-CLIP	23446348
MIRT517886	hsa-miR-6821-3p	PAR-CLIP	23446348
MIRT517885	hsa-miR-6778-3p	PAR-CLIP	23446348
MIRT517884	hsa-miR-378a-5p	PAR-CLIP	23446348
MIRT542167	hsa-miR-1227-3p	PAR-CLIP	27292025
MIRT542172	hsa-miR-1273g-3p	PAR-CLIP	27292025
MIRT542169	hsa-miR-191-3p	PAR-CLIP	27292025
MIRT542168	hsa-miR-4252	PAR-CLIP	27292025
MIRT542166	hsa-miR-6512-3p	PAR-CLIP	27292025
MIRT542165	hsa-miR-6720-5p	PAR-CLIP	27292025
MIRT542171	hsa-miR-6849-3p	PAR-CLIP	27292025
MIRT542170	hsa-miR-766-3p	PAR-CLIP	27292025
MIRT666092	hsa-miR-5197-5p	HITS-CLIP	23824327
MIRT666091	hsa-miR-130a-3p	HITS-CLIP	23824327
MIRT666090	hsa-miR-130b-3p	HITS-CLIP	23824327
MIRT666089	hsa-miR-301a-3p	HITS-CLIP	23824327
MIRT666088	hsa-miR-301b-3p	HITS-CLIP	23824327
MIRT666087	hsa-miR-3666	HITS-CLIP	23824327
MIRT666086	hsa-miR-4295	HITS-CLIP	23824327
MIRT666085	hsa-miR-454-3p	HITS-CLIP	23824327
MIRT666084	hsa-miR-183-5p	HITS-CLIP	23824327
MIRT666083	hsa-miR-6736-3p	HITS-CLIP	23824327
MIRT666082	hsa-miR-6787-3p	HITS-CLIP	23824327
MIRT666081	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT666080	hsa-miR-3135b	HITS-CLIP	23824327
MIRT666079	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT666078	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT666077	hsa-miR-564	HITS-CLIP	23824327
MIRT666076	hsa-miR-3652	HITS-CLIP	23824327
MIRT666075	hsa-miR-4430	HITS-CLIP	23824327
MIRT666074	hsa-miR-106a-3p	HITS-CLIP	23824327
MIRT647875	hsa-miR-6875-3p	HITS-CLIP	23824327
MIRT647874	hsa-miR-4659a-3p	HITS-CLIP	23824327
MIRT647873	hsa-miR-4659b-3p	HITS-CLIP	23824327
MIRT542172	hsa-miR-1273g-3p	PAR-CLIP	21572407
MIRT542171	hsa-miR-6849-3p	PAR-CLIP	21572407
MIRT542170	hsa-miR-766-3p	PAR-CLIP	21572407
MIRT542169	hsa-miR-191-3p	PAR-CLIP	21572407
MIRT542168	hsa-miR-4252	PAR-CLIP	21572407
MIRT542167	hsa-miR-1227-3p	PAR-CLIP	21572407
MIRT542166	hsa-miR-6512-3p	PAR-CLIP	21572407
MIRT542165	hsa-miR-6720-5p	PAR-CLIP	21572407
MIRT517888	hsa-miR-3653-5p	PAR-CLIP	23446348
MIRT517887	hsa-miR-6790-3p	PAR-CLIP	23446348
MIRT517886	hsa-miR-6821-3p	PAR-CLIP	23446348
MIRT517885	hsa-miR-6778-3p	PAR-CLIP	23446348
MIRT517884	hsa-miR-378a-5p	PAR-CLIP	23446348
MIRT1392829	hsa-miR-1224-3p	CLIP-seq
MIRT1392830	hsa-miR-1245	CLIP-seq
MIRT1392831	hsa-miR-1294	CLIP-seq
MIRT1392832	hsa-miR-1827	CLIP-seq
MIRT1392833	hsa-miR-197	CLIP-seq
MIRT1392834	hsa-miR-2355-5p	CLIP-seq
MIRT1392835	hsa-miR-2467-3p	CLIP-seq
MIRT1392836	hsa-miR-3154	CLIP-seq
MIRT1392837	hsa-miR-3159	CLIP-seq
MIRT1392838	hsa-miR-3170	CLIP-seq
MIRT1392839	hsa-miR-3184	CLIP-seq
MIRT1392840	hsa-miR-3612	CLIP-seq
MIRT1392841	hsa-miR-3622a-5p	CLIP-seq
MIRT1392842	hsa-miR-3679-3p	CLIP-seq
MIRT1392843	hsa-miR-3689a-3p	CLIP-seq
MIRT1392844	hsa-miR-3689c	CLIP-seq
MIRT1392845	hsa-miR-3934	CLIP-seq
MIRT1392846	hsa-miR-3975	CLIP-seq
MIRT1392847	hsa-miR-423-5p	CLIP-seq
MIRT1392848	hsa-miR-4269	CLIP-seq
MIRT1392849	hsa-miR-4286	CLIP-seq
MIRT1392850	hsa-miR-4316	CLIP-seq
MIRT1392851	hsa-miR-4422	CLIP-seq
MIRT1392852	hsa-miR-4436b-3p	CLIP-seq
MIRT1392853	hsa-miR-4438	CLIP-seq
MIRT1392854	hsa-miR-4464	CLIP-seq
MIRT1392855	hsa-miR-4651	CLIP-seq
MIRT1392856	hsa-miR-4701-5p	CLIP-seq
MIRT1392857	hsa-miR-4728-5p	CLIP-seq
MIRT1392858	hsa-miR-4748	CLIP-seq
MIRT1392859	hsa-miR-5095	CLIP-seq
MIRT1392860	hsa-miR-5096	CLIP-seq
MIRT1392861	hsa-miR-548ae	CLIP-seq
MIRT1392862	hsa-miR-548aj	CLIP-seq
MIRT1392863	hsa-miR-548am	CLIP-seq
MIRT1392864	hsa-miR-548x	CLIP-seq
MIRT1392865	hsa-miR-608	CLIP-seq
MIRT1392866	hsa-miR-640	CLIP-seq
MIRT1392867	hsa-miR-650	CLIP-seq
MIRT1392868	hsa-miR-940	CLIP-seq
MIRT2117895	hsa-miR-1178	CLIP-seq
MIRT1392830	hsa-miR-1245	CLIP-seq
MIRT2117896	hsa-miR-1297	CLIP-seq
MIRT2117897	hsa-miR-150	CLIP-seq
MIRT2117898	hsa-miR-1976	CLIP-seq
MIRT2117899	hsa-miR-216a	CLIP-seq
MIRT2117900	hsa-miR-217	CLIP-seq
MIRT2117901	hsa-miR-26a	CLIP-seq
MIRT2117902	hsa-miR-26b	CLIP-seq
MIRT2117903	hsa-miR-3155	CLIP-seq
MIRT2117904	hsa-miR-3155b	CLIP-seq
MIRT2117905	hsa-miR-3977	CLIP-seq
MIRT2117906	hsa-miR-4279	CLIP-seq
MIRT1392850	hsa-miR-4316	CLIP-seq
MIRT2117907	hsa-miR-4418	CLIP-seq
MIRT2117908	hsa-miR-4465	CLIP-seq
MIRT2117909	hsa-miR-4722-3p	CLIP-seq
MIRT2117910	hsa-miR-4772-3p	CLIP-seq
MIRT2117911	hsa-miR-4775	CLIP-seq
MIRT2117912	hsa-miR-484	CLIP-seq
MIRT2117913	hsa-miR-509-3-5p	CLIP-seq
MIRT2117914	hsa-miR-509-5p	CLIP-seq
MIRT2117915	hsa-miR-548m	CLIP-seq
MIRT2117916	hsa-miR-590-3p	CLIP-seq
MIRT2339858	hsa-miR-106a	CLIP-seq
MIRT2339859	hsa-miR-106b	CLIP-seq
MIRT2117895	hsa-miR-1178	CLIP-seq
MIRT1392829	hsa-miR-1224-3p	CLIP-seq
MIRT2339860	hsa-miR-1234	CLIP-seq
MIRT2117897	hsa-miR-150	CLIP-seq
MIRT2339861	hsa-miR-17	CLIP-seq
MIRT2339862	hsa-miR-20a	CLIP-seq
MIRT2339863	hsa-miR-20b	CLIP-seq
MIRT2117899	hsa-miR-216a	CLIP-seq
MIRT2339864	hsa-miR-302a	CLIP-seq
MIRT2339865	hsa-miR-302b	CLIP-seq
MIRT2339866	hsa-miR-302c	CLIP-seq
MIRT2339867	hsa-miR-302d	CLIP-seq
MIRT2339868	hsa-miR-302e	CLIP-seq
MIRT2117903	hsa-miR-3155	CLIP-seq
MIRT2117904	hsa-miR-3155b	CLIP-seq
MIRT2339869	hsa-miR-372	CLIP-seq
MIRT2339870	hsa-miR-373	CLIP-seq
MIRT1392845	hsa-miR-3934	CLIP-seq
MIRT2117905	hsa-miR-3977	CLIP-seq
MIRT2339871	hsa-miR-4731-5p	CLIP-seq
MIRT2117911	hsa-miR-4775	CLIP-seq
MIRT2117912	hsa-miR-484	CLIP-seq
MIRT1392859	hsa-miR-5095	CLIP-seq
MIRT2339872	hsa-miR-512-3p	CLIP-seq
MIRT2339873	hsa-miR-519d	CLIP-seq
MIRT2339874	hsa-miR-520a-3p	CLIP-seq
MIRT2339875	hsa-miR-520b	CLIP-seq
MIRT2339876	hsa-miR-520c-3p	CLIP-seq
MIRT2339877	hsa-miR-520d-3p	CLIP-seq
MIRT2339878	hsa-miR-520e	CLIP-seq
MIRT2339879	hsa-miR-520g	CLIP-seq
MIRT2339880	hsa-miR-520h	CLIP-seq
MIRT2117915	hsa-miR-548m	CLIP-seq
MIRT2339881	hsa-miR-552	CLIP-seq
MIRT2117916	hsa-miR-590-3p	CLIP-seq
MIRT1392866	hsa-miR-640	CLIP-seq
MIRT2339882	hsa-miR-93	CLIP-seq
MIRT1392831	hsa-miR-1294	CLIP-seq
MIRT1392839	hsa-miR-3184	CLIP-seq
MIRT1392843	hsa-miR-3689a-3p	CLIP-seq
MIRT1392844	hsa-miR-3689c	CLIP-seq
MIRT1392845	hsa-miR-3934	CLIP-seq
MIRT1392847	hsa-miR-423-5p	CLIP-seq
MIRT1392850	hsa-miR-4316	CLIP-seq
MIRT1392855	hsa-miR-4651	CLIP-seq
MIRT1392857	hsa-miR-4728-5p	CLIP-seq
MIRT1392865	hsa-miR-608	CLIP-seq
MIRT2433585	hsa-miR-1279	CLIP-seq
MIRT2433586	hsa-miR-1305	CLIP-seq
MIRT2433587	hsa-miR-4461	CLIP-seq
MIRT2433588	hsa-miR-4731-3p	CLIP-seq
MIRT2433589	hsa-miR-4801	CLIP-seq
MIRT2117896	hsa-miR-1297	CLIP-seq
MIRT2117897	hsa-miR-150	CLIP-seq
MIRT2117898	hsa-miR-1976	CLIP-seq
MIRT2117901	hsa-miR-26a	CLIP-seq
MIRT2117902	hsa-miR-26b	CLIP-seq
MIRT2633773	hsa-miR-3688-5p	CLIP-seq
MIRT2117906	hsa-miR-4279	CLIP-seq
MIRT2633774	hsa-miR-4302	CLIP-seq
MIRT2117908	hsa-miR-4465	CLIP-seq
MIRT2633775	hsa-miR-4470	CLIP-seq
MIRT2633776	hsa-miR-4474-3p	CLIP-seq
MIRT2117896	hsa-miR-1297	CLIP-seq
MIRT2117897	hsa-miR-150	CLIP-seq
MIRT2117898	hsa-miR-1976	CLIP-seq
MIRT2117901	hsa-miR-26a	CLIP-seq
MIRT2117902	hsa-miR-26b	CLIP-seq
MIRT2633773	hsa-miR-3688-5p	CLIP-seq
MIRT2117906	hsa-miR-4279	CLIP-seq
MIRT2633774	hsa-miR-4302	CLIP-seq
MIRT2117908	hsa-miR-4465	CLIP-seq
MIRT2633775	hsa-miR-4470	CLIP-seq
MIRT2633776	hsa-miR-4474-3p	CLIP-seq
MIRT2117909	hsa-miR-4722-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
TP53	Repression	14695784

Show/Hide all (28)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004994	Function	Somatostatin receptor activity	IBA
GO:0004994	Function	Somatostatin receptor activity	IEA
GO:0004994	Function	Somatostatin receptor activity	TAS	7914078
GO:0005515	Function	Protein binding	IPI	10551867, 16917505, 18653781, 22651821
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	7914078
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	7914078
GO:0007193	Process	Adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9892014
GO:0016020	Component	Membrane	IEA
GO:0030165	Function	PDZ domain binding	IPI	10551867
GO:0038170	Process	Somatostatin signaling pathway	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0071385	Process	Cellular response to glucocorticoid stimulus	IBA
GO:0071392	Process	Cellular response to estradiol stimulus	IBA

MIM	HGNC	e!Ensembl
182452	11331	ENSG00000180616

P30874

Protein name

Somatostatin receptor type 2 (SS-2-R) (SS2-R) (SS2R) (SST2) (SRIF-1)

Protein function

Receptor for somatostatin-14 and -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and PLC via pertussis toxin insensitive as well as s

PDB

7T10 , 7T11 , 7UL5 , 7WIC , 7WIG , 7WJ5 , 7XAT , 7XAU , 7XAV , 7XMR , 7Y24 , 7Y26 , 7Y27 , 7YAC , 7YAE

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00001	7tm_1	60 → 312	7 transmembrane receptor (rhodopsin family)	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in both pancreatic alpha- and beta-cells (at protein level). Expressed at higher levels in the pancreas than other somatostatin receptors. Also expressed in the cerebrum and kidney and, in lesser amounts, in the jejunum, colo

Sequence

MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCG
NTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMT
VDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIY
AGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGI
RVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVL
TYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTL
LNGDLQTSI

Sequence length

369

Interactions

View interactions

	KEGG		Reactome
	cAMP signaling pathway Neuroactive ligand-receptor interaction Hormone signaling Growth hormone synthesis, secretion and action Gastric acid secretion		Peptide ligand-binding receptors G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARAGANGLIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (157)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acromegaly	Acromegaly	BEFREE	10651751, 17941904, 25008035, 28835453, 30346538, 31219586, 31574507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	28434012	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	16625843, 28434012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	11311492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12781040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	15257106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	20578838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	15205362, 15257106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10443675, 10690891, 11231991, 11264647, 11434667, 12807513, 15914528, 22200580, 28434012, 31167164, 8866248, 9059557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	21042045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	12920656, 28033222, 30529752, 7775631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	37185426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Stable	Angina pectoris	Pubtator	34980502	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	27682590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19324939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	11762340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19324939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	8674827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	7768398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	34392560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11311492, 14687472, 16214911, 19575008, 25075022, 25925002, 26251419, 28107508, 9062398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19575008, 26251419, 28107508, 9062398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33318294	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	30510283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	21319031, 36697023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31336364, 31540828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15456543, 29282035	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	37540574	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	26796520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28542563, 30152518, 30621480, 7968260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	27682590, 39682758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29282035, 33962620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	7768398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	8106629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	16771832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	16610049	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28782576, 31244652		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	11839658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16610049, 22056254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	16771832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	18951627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	26567922, 34497584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	21383526	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cushing Syndrome	Cushing syndrome	Pubtator	21319031	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	32312960	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28988629		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dwarfism Pituitary	Pituitary dwarfism	Pubtator	26391562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	29750706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	LHGDN	16254490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	16771832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	9726814	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	24565507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	10768564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	23116418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	16771832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	11762340	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29029435, 7595483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucagonoma	Glucagonoma	BEFREE	12021920, 8132773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	18951627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	20450431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	17848636, 33886620	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Hormone-Secreting Pituitary Adenoma	Somatotroph Adenoma	BEFREE	10443675, 10651751, 12788890, 27455094, 8866248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	10768564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperpituitarism	Hyperpituitarism	Pubtator	17420609	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19324939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	LHGDN	14602773		★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	16601280, 19917848, 8132773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Islet Cell Tumor	Islet Cell Tumor	BEFREE	24565507, 31543319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	16771832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	26796520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26796520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10768564, 15991301, 19590186, 27391928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	30038293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	30448769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	20653396, 23962694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	28542563	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11311492, 14687472, 16214911, 19575008, 25075022, 25925002, 26251419, 28107508, 9062398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28542563, 30152518, 30621480, 31334537, 7968260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	14572771, 15145694, 15205362, 15259086, 15641137, 25890201, 27682590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	15259086, 17625444, 19917848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	24211300, 24824313, 25010045, 30400059, 9253335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18759148, 19148511, 22056254, 23435724, 25010045, 25890201, 28542563, 31413814		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15336655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	10768564, 12053094, 12063634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	11386415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	11762340	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	15015781, 18808065, 28128725, 28450556, 29858948, 30691608, 30877475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	18695896, 18808065		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	18808065, 25635133, 28450556, 29858948, 33899156, 35487628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29774076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	36697134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10604740, 10768564, 11061551, 11231991, 11264647, 11884502, 12894529, 14572771, 15257106, 15641137, 16625841, 17420609, 18299461, 18682975, 18759148 View all (53 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10604740, 11061551, 17678886, 29043399, 29097943, 30334904, 9815638, 9816127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10604740, 30334904, 33990938	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	12675130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	24565507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	16625843, 18697876, 20423238, 23797089, 24238043, 24565897, 27539020, 27539256, 28178157, 28454229, 29422331, 29681888, 29912750, 30594453, 30735385 View all (6 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	CTD_human_DG	17625444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	LHGDN	18196892, 18697876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	Pubtator	33899156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	32666581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	18951627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	19318729, 28120505		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	20653396, 23962694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	20948194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	28107508	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27461627	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14572771, 15145694, 15205362, 15259086, 15641137, 25890201, 27682590		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12490654, 14572771, 14760765, 15205362, 15754023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	15259086, 17625444, 19917848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	14760765, 15259086, 25890201, 27682590, 30747226	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15870276	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis	Pancreatitis	Pubtator	25890201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	28033222		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paraganglioma	Paraganglioma	CTD_human_DG	29163802		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Paraganglioma	Paraganglioma	Pubtator	30529752	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Periodontitis	Periodontitis	BEFREE	30609928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Petit mal status	Petit Mal Status	CTD_human_DG	18951627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	12920656, 28033222, 30529752, 7775631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	Pubtator	26996779, 36946182, 8132773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	28434012, 8866248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	24098585	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	39202532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	BEFREE	30261745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	8866248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	24211300, 24824313, 25010045, 30400059, 9253335		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12210479, 12474541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20646346, 24824313, 25010045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	31197742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	12894529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Single Seizure	Seizure	CTD_human_DG	16771832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	10604740, 29511449, 30735385, 31334537, 31413814, 31649014, 7854974, 7968260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	10604740, 28182792, 39310095	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26796520	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	18951627		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	18951627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	30510283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	35487628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Teratoma	Teratoma	BEFREE	29774076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	17848636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer Hurthle cell	Hurthle cell thyroid cancer	Pubtator	10768564, 37716507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	10768564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	30415874		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid Diseases	BEFREE	20450431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	10768564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	10768564, 16996150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	20686293, 37716507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	20450431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyrotroph adenoma	Adenoma	BEFREE	28434012		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tonic - clonic seizures	Seizure	CTD_human_DG	16771832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	38125789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 2 (disorder)	Tuberous Sclerosis	BEFREE	19917848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	18682975, 29949880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	29949880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	36697134	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	16771832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Warburg Sjo Fledelius syndrome	Warburg micro syndrome	Pubtator	39202532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SSTR2 (somatostatin receptor 2)