SSTR1 (somatostatin receptor 1)

Gene

• Entrez ID: 6751
• Gene name: Somatostatin receptor 1
• Gene symbol: SSTR1
• Synonyms (NCBI Gene): SRIF-2, SS-1-R, SS1-R, SS1R, SST1
• Chromosome: 14
• Chromosome location: 14q21.1
• Summary: Somatostatins are peptide hormones that regulate diverse cellular functions such as neurotransmission, cell proliferation, and endocrine signaling as well as inhibiting the release of many hormones and other secretory proteins. Somatostatin has two active

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484400	hsa-miR-4285	PAR-CLIP	20371350
MIRT484401	hsa-miR-4767	PAR-CLIP	20371350
MIRT484399	hsa-miR-4467	PAR-CLIP	20371350
MIRT484398	hsa-miR-8089	PAR-CLIP	20371350
MIRT490694	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT490693	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT490692	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT490691	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT490690	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT490689	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490688	hsa-miR-501-3p	PAR-CLIP	23592263
MIRT490687	hsa-miR-502-3p	PAR-CLIP	23592263
MIRT484400	hsa-miR-4285	PAR-CLIP	23592263
MIRT490686	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT484401	hsa-miR-4767	PAR-CLIP	23592263
MIRT490685	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490684	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT484399	hsa-miR-4467	PAR-CLIP	23592263
MIRT490683	hsa-miR-3153	PAR-CLIP	23592263
MIRT490682	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490681	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490680	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490679	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT490678	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT490677	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT490676	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490675	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT484398	hsa-miR-8089	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT484400	hsa-miR-4285	PAR-CLIP	23592263
MIRT484401	hsa-miR-4767	PAR-CLIP	23592263
MIRT484399	hsa-miR-4467	PAR-CLIP	23592263
MIRT484398	hsa-miR-8089	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT484400	hsa-miR-4285	PAR-CLIP	20371350
MIRT484401	hsa-miR-4767	PAR-CLIP	20371350
MIRT484399	hsa-miR-4467	PAR-CLIP	20371350
MIRT484398	hsa-miR-8089	PAR-CLIP	20371350
MIRT490694	hsa-miR-5584-5p	PAR-CLIP	23592263
MIRT490693	hsa-miR-4436b-3p	PAR-CLIP	23592263
MIRT490692	hsa-miR-4632-5p	PAR-CLIP	23592263
MIRT490691	hsa-miR-6735-5p	PAR-CLIP	23592263
MIRT490690	hsa-miR-6879-5p	PAR-CLIP	23592263
MIRT490689	hsa-miR-7843-5p	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT490688	hsa-miR-501-3p	PAR-CLIP	23592263
MIRT490687	hsa-miR-502-3p	PAR-CLIP	23592263
MIRT484400	hsa-miR-4285	PAR-CLIP	23592263
MIRT490686	hsa-miR-3616-3p	PAR-CLIP	23592263
MIRT484401	hsa-miR-4767	PAR-CLIP	23592263
MIRT490685	hsa-miR-1207-5p	PAR-CLIP	23592263
MIRT490684	hsa-miR-4763-3p	PAR-CLIP	23592263
MIRT484399	hsa-miR-4467	PAR-CLIP	23592263
MIRT490683	hsa-miR-3153	PAR-CLIP	23592263
MIRT490682	hsa-miR-6733-5p	PAR-CLIP	23592263
MIRT490681	hsa-miR-6739-5p	PAR-CLIP	23592263
MIRT490680	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT490679	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT490678	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT490677	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT490676	hsa-miR-6721-5p	PAR-CLIP	23592263
MIRT490675	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT484398	hsa-miR-8089	PAR-CLIP	23592263
MIRT484403	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT484402	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT484400	hsa-miR-4285	PAR-CLIP	23592263
MIRT484401	hsa-miR-4767	PAR-CLIP	23592263
MIRT484399	hsa-miR-4467	PAR-CLIP	23592263
MIRT484398	hsa-miR-8089	PAR-CLIP	23592263
MIRT1392815	hsa-miR-1228	CLIP-seq
MIRT1392816	hsa-miR-342-3p	CLIP-seq
MIRT1392817	hsa-miR-3920	CLIP-seq
MIRT1392818	hsa-miR-3940-5p	CLIP-seq
MIRT1392819	hsa-miR-3942-5p	CLIP-seq
MIRT1392820	hsa-miR-4326	CLIP-seq
MIRT1392821	hsa-miR-4422	CLIP-seq
MIRT1392822	hsa-miR-4507	CLIP-seq
MIRT1392823	hsa-miR-4691-5p	CLIP-seq
MIRT1392824	hsa-miR-4700-3p	CLIP-seq
MIRT1392825	hsa-miR-4703-5p	CLIP-seq
MIRT1392826	hsa-miR-4762-3p	CLIP-seq
MIRT1392827	hsa-miR-578	CLIP-seq
MIRT1392828	hsa-miR-635	CLIP-seq
MIRT2117888	hsa-miR-1908	CLIP-seq
MIRT2117889	hsa-miR-1915	CLIP-seq
MIRT2117890	hsa-miR-3613-3p	CLIP-seq
MIRT2117891	hsa-miR-361-3p	CLIP-seq
MIRT2117892	hsa-miR-4707-3p	CLIP-seq
MIRT2117893	hsa-miR-4766-5p	CLIP-seq
MIRT2117894	hsa-miR-663	CLIP-seq
MIRT2339839	hsa-miR-1185	CLIP-seq
MIRT2339840	hsa-miR-1262	CLIP-seq
MIRT2339841	hsa-miR-1292	CLIP-seq
MIRT2339842	hsa-miR-1293	CLIP-seq
MIRT2339843	hsa-miR-2115	CLIP-seq
MIRT2339844	hsa-miR-3155	CLIP-seq
MIRT2339845	hsa-miR-3155b	CLIP-seq
MIRT2339846	hsa-miR-3158-3p	CLIP-seq
MIRT2339847	hsa-miR-3679-5p	CLIP-seq
MIRT2339848	hsa-miR-4259	CLIP-seq
MIRT2339849	hsa-miR-4471	CLIP-seq
MIRT2339850	hsa-miR-4483	CLIP-seq
MIRT2339851	hsa-miR-4701-3p	CLIP-seq
MIRT2339852	hsa-miR-4703-3p	CLIP-seq
MIRT2339853	hsa-miR-4715-5p	CLIP-seq
MIRT2339854	hsa-miR-4721	CLIP-seq
MIRT2339855	hsa-miR-484	CLIP-seq
MIRT2339856	hsa-miR-508-5p	CLIP-seq
MIRT2339857	hsa-miR-767-3p	CLIP-seq
MIRT2433573	hsa-miR-149	CLIP-seq
MIRT2433574	hsa-miR-2054	CLIP-seq
MIRT2433575	hsa-miR-3064-5p	CLIP-seq
MIRT2433576	hsa-miR-3065-5p	CLIP-seq
MIRT2433577	hsa-miR-3613-5p	CLIP-seq
MIRT2433578	hsa-miR-374c	CLIP-seq
MIRT2433579	hsa-miR-3925-3p	CLIP-seq
MIRT2433580	hsa-miR-4445	CLIP-seq
MIRT2433581	hsa-miR-4794	CLIP-seq
MIRT2433582	hsa-miR-495	CLIP-seq
MIRT2433583	hsa-miR-655	CLIP-seq
MIRT2433584	hsa-miR-766	CLIP-seq
MIRT2460573	hsa-miR-3919	CLIP-seq
MIRT2460574	hsa-miR-642b	CLIP-seq
MIRT2460573	hsa-miR-3919	CLIP-seq
MIRT2633772	hsa-miR-4489	CLIP-seq
MIRT2460573	hsa-miR-3919	CLIP-seq
MIRT2633772	hsa-miR-4489	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
EZH2	Repression	22144423

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0004994	Function	Somatostatin receptor activity	IBA
GO:0004994	Function	Somatostatin receptor activity	IDA	1346068
GO:0004994	Function	Somatostatin receptor activity	IEA
GO:0004994	Function	Somatostatin receptor activity	TAS	8405411
GO:0005515	Function	Protein binding	IPI	15247250
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	IEA
GO:0007187	Process	G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger	TAS	8405411
GO:0007215	Process	Glutamate receptor signaling pathway	IEA
GO:0007218	Process	Neuropeptide signaling pathway	IBA
GO:0007218	Process	Neuropeptide signaling pathway	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9886848
GO:0016020	Component	Membrane	IEA
GO:0021549	Process	Cerebellum development	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0038170	Process	Somatostatin signaling pathway	IEA
GO:0042594	Process	Response to starvation	IEA
GO:0042923	Function	Neuropeptide binding	IBA
GO:0043005	Component	Neuron projection	IBA
GO:0071392	Process	Cellular response to estradiol stimulus	IBA
GO:0071392	Process	Cellular response to estradiol stimulus	IEA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA

Other IDs

• MIM: 182451
• HGNC: 11330
• e!Ensembl: ENSG00000139874

Protein

• UniProt ID: P30872
• Protein name: Somatostatin receptor type 1 (SS-1-R) (SS1-R) (SS1R) (SST1) (SRIF-2)
• Protein function: Receptor for somatostatin with higher affinity for somatostatin-14 than -28. This receptor is coupled via pertussis toxin sensitive G proteins to inhibition of adenylyl cyclase. In addition it stimulates phosphotyrosine phosphatase and Na(+)/H(+
• PDB: 8XIO, 8XIP
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00001	7tm_1	75 → 323	7 transmembrane receptor (rhodopsin family)	Family

• Tissue specificity: TISSUE SPECIFICITY: Fetal kidney, fetal liver, and adult pancreas, brain, lung, jejunum and stomach.
• Sequence:

  MFPNGTASSPSSSPSPSPGSCGEGGGSRGPGAGAADGMEEPGRNASQNGTLSEGQGSAIL
  ISFIYSVVCLVGLCGNSMVIYVILRYAKMKTATNIYILNLAIADELLMLSVPFLVTSTLL
  RHWPFGALLCRLVLSVDAVNMFTSIYCLTVLSVDRYVAVVHPIKAARYRRPTVAKVVNLG
  VWVLSLLVILPIVVFSRTAANSDGTVACNMLMPEPAQRWLVGFVLYTFLMGFLLPVGAIC
  LCYVLIIAKMRMVALKAGWQQRKRSERKITLMVMMVVMVFVICWMPFYVVQLVNVFAEQD
  DATVSQLSVILGYANSCANPILYGFLSDNFKRSFQRILCLSWMDNAAEEPVDYYATALKS
  RAYSVEDFQPENLESGGVFRNGTCTSRITTL

• Sequence length: 391

Pathways

KEGG:

cAMP signaling pathway
Neuroactive ligand-receptor interaction
Hormone signaling
Growth hormone synthesis, secretion and action

Reactome:

Peptide ligand-binding receptors
G alpha (i) signalling events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLOR VISION DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STATUS EPILEPTICUS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	29455389, 30650942		★☆☆☆☆ Found in Text Mining only
Actinic keratosis	Actinic keratosis	BEFREE	11311492		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	7968260		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12788890, 17420609, 20797424, 31336364		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	12788890		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Neoplasms	Adrenal neoplasia	BEFREE	21042045		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	7775631		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	34220331	Associate	★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	20094970		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	30415874		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	10843877	Associate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	8674827		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24922657		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11311492, 30675231		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35793235	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	11772967, 8132773	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31336364		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	15247189	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24922657		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	7968260		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	29282035	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27927191		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16610049, 27927191	Associate	★☆☆☆☆ Found in Text Mining only
Complex Partial Status Epilepticus	Status Epilepticus	CTD_human_DG	18951627		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	29750706		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29750706, 30405748		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	22022585		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	23418513	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	23116418		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	32626960	Associate	★☆☆☆☆ Found in Text Mining only
Grand Mal Status Epilepticus	Grand Mal Status Epilepticus	CTD_human_DG	18951627		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	17848636	Associate	★☆☆☆☆ Found in Text Mining only
Growth Hormone Deficiency With Pituitary Anomalies	Growth hormone deficiency with pituitary anomalies	Pubtator	26391562	Associate	★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	28094316		★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	33297556	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	30607746		★☆☆☆☆ Found in Text Mining only
Hyperpituitarism	Hyperpituitarism	Pubtator	17420609	Associate	★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	19956410	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27391928		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16610049	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11311492, 30675231		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	7968260		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15706439, 18823376		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	17625444		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19423539, 24211300, 28905400, 9253335		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	23722468		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24922657		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28905400		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27927191		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15986128		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	12063634, 28948577		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	33899156	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11443154, 12788890, 15986128, 16601280, 18823376, 20423238, 22156600, 23722468, 25011056, 25641082, 25734919, 25765100, 30529752, 30657933, 8106629, 8515684, 9062398		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	CTD_human_DG	17625444		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	20423238		★☆☆☆☆ Found in Text Mining only
Non-Convulsive Status Epilepticus	Nonconvulsive status epilepticus	CTD_human_DG	18951627		★☆☆☆☆ Found in Text Mining only
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	19318729		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	25734919	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15706439, 18823376		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	17625444		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18823376		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	29596435	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Petit mal status	Petit Mal Status	CTD_human_DG	18951627		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	7775631		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	8866248		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	12788890		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	19318729	Stimulate	★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	26607296	Associate	★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	10487698, 20797424		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19423539, 24211300, 28905400, 9253335		★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasia	Prostatic intraepithelial neoplasia	Pubtator	20966542	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12474541, 18347174		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20935156	Associate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	15472172		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	25494861, 7968260		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	7968260		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25734919	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25734919		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	CTD_human_DG	18951627		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Status Epilepticus, Subclinical	Status Epilepticus	CTD_human_DG	18951627		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23722468		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	17848636		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	12359227		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	20094970		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	10768564, 20686293	Associate	★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	23672766	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	29949880		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	29949880	Associate	★☆☆☆☆ Found in Text Mining only