Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6734
Gene name	SRP receptor subunit alpha
Gene symbol	SRPRA
Synonyms (NCBI Gene)	DPSRPRSralpha
Chromosome	11
Chromosome location	11q24.2
Summary	The gene encodes a subunit of the endoplasmic reticulum signal recognition particle receptor that, in conjunction with the signal recognition particle, is involved in the targeting and translocation of signal sequence tagged secretory and membrane protein

Show/Hide all (89)

miRTarBase ID	miRNA	Experiments	Reference
MIRT500939	hsa-miR-195-5p	HITS-CLIP	23313552
MIRT500938	hsa-miR-15b-5p	HITS-CLIP	23313552
MIRT500937	hsa-miR-497-5p	HITS-CLIP	23313552
MIRT500936	hsa-miR-15a-5p	HITS-CLIP	23313552
MIRT500935	hsa-miR-424-5p	HITS-CLIP	23313552
MIRT500934	hsa-miR-6838-5p	HITS-CLIP	23313552
MIRT001409	hsa-miR-16-5p	HITS-CLIP	23313552
MIRT500933	hsa-miR-503-5p	HITS-CLIP	23313552
MIRT553997	hsa-miR-6757-3p	HITS-CLIP	23313552
MIRT500932	hsa-miR-646	HITS-CLIP	23313552
MIRT698874	hsa-miR-128-3p	HITS-CLIP	23313552
MIRT698873	hsa-miR-216a-3p	HITS-CLIP	23313552
MIRT698872	hsa-miR-3681-3p	HITS-CLIP	23313552
MIRT698871	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT553994	hsa-miR-4742-5p	HITS-CLIP	23313552
MIRT698870	hsa-miR-3197	HITS-CLIP	23313552
MIRT698869	hsa-miR-6087	HITS-CLIP	23313552
MIRT698868	hsa-miR-3656	HITS-CLIP	23313552
MIRT698867	hsa-miR-4316	HITS-CLIP	23313552
MIRT500930	hsa-miR-4524a-5p	HITS-CLIP	23313552
MIRT500929	hsa-miR-4524b-5p	HITS-CLIP	23313552
MIRT698866	hsa-miR-6765-5p	HITS-CLIP	23313552
MIRT698865	hsa-miR-3064-3p	HITS-CLIP	23313552
MIRT500928	hsa-miR-374b-3p	HITS-CLIP	23313552
MIRT500939	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT500938	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT500937	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT500936	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT500935	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT500934	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT001409	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT500933	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT553997	hsa-miR-6757-3p	PAR-CLIP	21572407
MIRT500932	hsa-miR-646	PAR-CLIP	21572407
MIRT553996	hsa-miR-4433b-3p	PAR-CLIP	21572407
MIRT500931	hsa-miR-2115-3p	PAR-CLIP	21572407
MIRT553995	hsa-miR-6514-5p	PAR-CLIP	21572407
MIRT553994	hsa-miR-4742-5p	PAR-CLIP	21572407
MIRT553993	hsa-miR-1251-3p	PAR-CLIP	21572407
MIRT553992	hsa-miR-6881-5p	PAR-CLIP	21572407
MIRT553991	hsa-miR-30a-5p	PAR-CLIP	21572407
MIRT023411	hsa-miR-30b-5p	PAR-CLIP	21572407
MIRT553990	hsa-miR-30c-5p	PAR-CLIP	21572407
MIRT553989	hsa-miR-30d-5p	PAR-CLIP	21572407
MIRT553988	hsa-miR-30e-5p	PAR-CLIP	21572407
MIRT500930	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT500929	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT553987	hsa-miR-6737-5p	PAR-CLIP	21572407
MIRT553986	hsa-miR-6812-5p	PAR-CLIP	21572407
MIRT553985	hsa-miR-6819-5p	PAR-CLIP	21572407
MIRT553984	hsa-miR-3170	PAR-CLIP	21572407
MIRT553983	hsa-miR-6855-5p	PAR-CLIP	21572407
MIRT500928	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT553982	hsa-miR-450a-2-3p	PAR-CLIP	21572407
MIRT553981	hsa-miR-4260	PAR-CLIP	21572407
MIRT553980	hsa-miR-5572	PAR-CLIP	21572407
MIRT500939	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT500938	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT500937	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT500936	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT500935	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT500934	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT001409	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT500933	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT500932	hsa-miR-646	PAR-CLIP	21572407
MIRT500931	hsa-miR-2115-3p	PAR-CLIP	21572407
MIRT500930	hsa-miR-4524a-5p	PAR-CLIP	21572407
MIRT500929	hsa-miR-4524b-5p	PAR-CLIP	21572407
MIRT500928	hsa-miR-374b-3p	PAR-CLIP	21572407
MIRT500939	hsa-miR-195-5p	PAR-CLIP	24398324
MIRT500938	hsa-miR-15b-5p	PAR-CLIP	24398324
MIRT500937	hsa-miR-497-5p	PAR-CLIP	24398324
MIRT500936	hsa-miR-15a-5p	PAR-CLIP	24398324
MIRT500935	hsa-miR-424-5p	PAR-CLIP	24398324
MIRT500934	hsa-miR-6838-5p	PAR-CLIP	24398324
MIRT001409	hsa-miR-16-5p	PAR-CLIP	24398324
MIRT500933	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT500932	hsa-miR-646	PAR-CLIP	24398324
MIRT500931	hsa-miR-2115-3p	PAR-CLIP	24398324
MIRT500930	hsa-miR-4524a-5p	PAR-CLIP	24398324
MIRT500929	hsa-miR-4524b-5p	PAR-CLIP	24398324
MIRT500928	hsa-miR-374b-3p	PAR-CLIP	24398324
MIRT500936	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT500938	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT001409	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT500939	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT049696	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT726452	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT726451	hsa-miR-32-5p	HITS-CLIP	22473208

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0005047	Function	Signal recognition particle binding	IBA
GO:0005047	Function	Signal recognition particle binding	IEA
GO:0005515	Function	Protein binding	IPI	33053321
GO:0005525	Function	GTP binding	IEA
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005785	Component	Signal recognition particle receptor complex	EXP	16439358
GO:0005785	Component	Signal recognition particle receptor complex	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS	2827661
GO:0006613	Process	Cotranslational protein targeting to membrane	TAS	2827661
GO:0006614	Process	SRP-dependent cotranslational protein targeting to membrane	IEA
GO:0006617	Process	SRP-dependent cotranslational protein targeting to membrane, signal sequence recognition	NAS	16439358
GO:0006886	Process	Intracellular protein transport	IEA
GO:0016020	Component	Membrane	IDA	22375059
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	16439358
GO:0045047	Process	Protein targeting to ER	IBA
GO:0070062	Component	Extracellular exosome	HDA	19199708

MIM	HGNC	e!Ensembl
182180	11307	ENSG00000182934

P08240

Protein name

Signal recognition particle receptor subunit alpha (SR-alpha) (Docking protein alpha) (DP-alpha)

Protein function

Component of the signal recognition particle (SRP) complex receptor (SR) (PubMed:16439358). Ensures, in conjunction with the SRP complex, the correct targeting of the nascent secretory proteins to the endoplasmic reticulum membrane system (PubMe

PDB

2FH5 , 2GO5 , 5L3Q , 6Y32 , 7NFX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04086	SRP-alpha_N	27 → 303	Signal recognition particle, alpha subunit, N-terminal	Family
PF02881	SRP54_N	317 → 393	SRP54-type protein, helical bundle domain	Domain
PF00448	SRP54	418 → 637	SRP54-type protein, GTPase domain	Domain

Sequence

MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLDN
QFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRL
LREAEESSKIRAPTTMKKFEDSEKAKKPVRSMIETRGEKPKEKAKNSKKKGAKKEGSDGP
LATSKPVPAEKSGLPVGPENGVELSKEELIRRKREEFIQKHGRGMEKSNKSTKSDAPKEK
GKKAPRVWELGGCANKEVLDYSTPTTNGTPEAALSEDINLIRGTGSGGQLQDLDCSSSDD
EGAAQNSTKPSATKGTLGGMFGMLKGLVGSKSLSREDMESVLDKMRDHLIAKNVAADIAV
QLCESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQRRVDMLRDIMDAQRRQRPYV
VTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAGAVEQLRTHTRRLSALHPPEK
HGGRTMVQLFEKGYGKDAAGIAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLIT
VNTPDLVLFVGEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGAA
ISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA

Sequence length

638

Interactions

View interactions

	KEGG		Reactome
	Protein export		XBP1(S) activates chaperone genes

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Severe congenital neutropenia	Pathogenic	rs1950780024	RCV001199430	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Shwachman-Diamond syndrome 1	Pathogenic	rs1950780024	RCV001199430	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SHWACHMAN-DIAMOND SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SRPRA-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (23)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	22278060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	28387872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Berylliosis	Berylliosis	Pubtator	22972925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	35325485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	17060025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	2788285	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic colitis	Colitis	BEFREE	9449719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11139429	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hypothyroidism	Congenital hypothyroidism	Pubtator	8099855	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Herpetiformis	Dermatitis herpetiformis	Pubtator	1919044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	38498185	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft vs Host Disease	Graft-versus-host disease	Pubtator	8423212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	3146453	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	2491614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	8664118	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	3283252	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	35192775	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	32357537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pemphigus	Pemphigus	Pubtator	25010392	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28495492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Synovitis	Synovitis	Pubtator	1281621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroiditis Autoimmune	Thyroiditis	Pubtator	3117460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26209610	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SRPRA (SRP receptor subunit alpha)