Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	6733
Gene name	SRSF protein kinase 2
Gene symbol	SRPK2
Synonyms (NCBI Gene)	SFRSK2
Chromosome	7
Chromosome location	7q22.3

320

Show/Hide all (320)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020912	hsa-miR-155-5p	Proteomics	18668040
MIRT025155	hsa-miR-181a-5p	Microarray	17612493
MIRT030965	hsa-miR-21-5p	Microarray	18591254
MIRT653145	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT653144	hsa-miR-4282	HITS-CLIP	23824327
MIRT653143	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT653142	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT653141	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT653140	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT653139	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT653138	hsa-miR-7977	HITS-CLIP	23824327
MIRT653137	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT653145	hsa-miR-548c-3p	HITS-CLIP	23824327
MIRT653144	hsa-miR-4282	HITS-CLIP	23824327
MIRT653143	hsa-miR-3606-3p	HITS-CLIP	23824327
MIRT653142	hsa-miR-513a-3p	HITS-CLIP	23824327
MIRT653141	hsa-miR-513c-3p	HITS-CLIP	23824327
MIRT653140	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT653139	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT653138	hsa-miR-7977	HITS-CLIP	23824327
MIRT653137	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT1389461	hsa-miR-101	CLIP-seq
MIRT1389462	hsa-miR-1261	CLIP-seq
MIRT1389463	hsa-miR-1278	CLIP-seq
MIRT1389464	hsa-miR-128	CLIP-seq
MIRT1389465	hsa-miR-1283	CLIP-seq
MIRT1389466	hsa-miR-1292	CLIP-seq
MIRT1389467	hsa-miR-1298	CLIP-seq
MIRT1389468	hsa-miR-148a	CLIP-seq
MIRT1389469	hsa-miR-148b	CLIP-seq
MIRT1389470	hsa-miR-152	CLIP-seq
MIRT1389471	hsa-miR-181a	CLIP-seq
MIRT1389472	hsa-miR-181b	CLIP-seq
MIRT1389473	hsa-miR-181c	CLIP-seq
MIRT1389474	hsa-miR-181d	CLIP-seq
MIRT1389475	hsa-miR-2053	CLIP-seq
MIRT1389476	hsa-miR-221	CLIP-seq
MIRT1389477	hsa-miR-222	CLIP-seq
MIRT1389478	hsa-miR-27a	CLIP-seq
MIRT1389479	hsa-miR-27b	CLIP-seq
MIRT1389480	hsa-miR-3121-3p	CLIP-seq
MIRT1389481	hsa-miR-3144-3p	CLIP-seq
MIRT1389482	hsa-miR-3153	CLIP-seq
MIRT1389483	hsa-miR-3189-3p	CLIP-seq
MIRT1389484	hsa-miR-330-3p	CLIP-seq
MIRT1389485	hsa-miR-3613-3p	CLIP-seq
MIRT1389486	hsa-miR-3617	CLIP-seq
MIRT1389487	hsa-miR-3692	CLIP-seq
MIRT1389488	hsa-miR-3975	CLIP-seq
MIRT1389489	hsa-miR-4262	CLIP-seq
MIRT1389490	hsa-miR-432	CLIP-seq
MIRT1389491	hsa-miR-4471	CLIP-seq
MIRT1389492	hsa-miR-4646-5p	CLIP-seq
MIRT1389493	hsa-miR-4659a-3p	CLIP-seq
MIRT1389494	hsa-miR-4659b-3p	CLIP-seq
MIRT1389495	hsa-miR-4698	CLIP-seq
MIRT1389496	hsa-miR-4709-5p	CLIP-seq
MIRT1389497	hsa-miR-4722-3p	CLIP-seq
MIRT1389498	hsa-miR-4777-3p	CLIP-seq
MIRT1389499	hsa-miR-4799-5p	CLIP-seq
MIRT1389500	hsa-miR-510	CLIP-seq
MIRT1389501	hsa-miR-512-5p	CLIP-seq
MIRT1389502	hsa-miR-515-5p	CLIP-seq
MIRT1389503	hsa-miR-520d-5p	CLIP-seq
MIRT1389504	hsa-miR-524-5p	CLIP-seq
MIRT1389505	hsa-miR-548ad	CLIP-seq
MIRT1389506	hsa-miR-548l	CLIP-seq
MIRT1389507	hsa-miR-548p	CLIP-seq
MIRT1389508	hsa-miR-569	CLIP-seq
MIRT1389509	hsa-miR-583	CLIP-seq
MIRT1389510	hsa-miR-617	CLIP-seq
MIRT1389511	hsa-miR-621	CLIP-seq
MIRT1389512	hsa-miR-641	CLIP-seq
MIRT1389513	hsa-miR-875-5p	CLIP-seq
MIRT1389464	hsa-miR-128	CLIP-seq
MIRT1389468	hsa-miR-148a	CLIP-seq
MIRT1389469	hsa-miR-148b	CLIP-seq
MIRT1389470	hsa-miR-152	CLIP-seq
MIRT1389471	hsa-miR-181a	CLIP-seq
MIRT1389472	hsa-miR-181b	CLIP-seq
MIRT1389473	hsa-miR-181c	CLIP-seq
MIRT1389474	hsa-miR-181d	CLIP-seq
MIRT1389514	hsa-miR-186	CLIP-seq
MIRT1389515	hsa-miR-2054	CLIP-seq
MIRT1389516	hsa-miR-208a	CLIP-seq
MIRT1389517	hsa-miR-208b	CLIP-seq
MIRT1389518	hsa-miR-2276	CLIP-seq
MIRT1389519	hsa-miR-2355-5p	CLIP-seq
MIRT1389520	hsa-miR-23a	CLIP-seq
MIRT1389521	hsa-miR-23b	CLIP-seq
MIRT1389522	hsa-miR-23c	CLIP-seq
MIRT1389478	hsa-miR-27a	CLIP-seq
MIRT1389479	hsa-miR-27b	CLIP-seq
MIRT1389523	hsa-miR-302f	CLIP-seq
MIRT1389524	hsa-miR-3133	CLIP-seq
MIRT1389481	hsa-miR-3144-3p	CLIP-seq
MIRT1389525	hsa-miR-3149	CLIP-seq
MIRT1389526	hsa-miR-3614-5p	CLIP-seq
MIRT1389486	hsa-miR-3617	CLIP-seq
MIRT1389527	hsa-miR-3658	CLIP-seq
MIRT1389528	hsa-miR-371-5p	CLIP-seq
MIRT1389488	hsa-miR-3975	CLIP-seq
MIRT1389489	hsa-miR-4262	CLIP-seq
MIRT1389529	hsa-miR-4267	CLIP-seq
MIRT1389530	hsa-miR-4693-3p	CLIP-seq
MIRT1389495	hsa-miR-4698	CLIP-seq
MIRT1389531	hsa-miR-4712-3p	CLIP-seq
MIRT1389532	hsa-miR-4774-3p	CLIP-seq
MIRT1389533	hsa-miR-4778-3p	CLIP-seq
MIRT1389534	hsa-miR-4786-3p	CLIP-seq
MIRT1389499	hsa-miR-4799-5p	CLIP-seq
MIRT1389535	hsa-miR-499-5p	CLIP-seq
MIRT1389536	hsa-miR-500a	CLIP-seq
MIRT1389537	hsa-miR-548k	CLIP-seq
MIRT1389538	hsa-miR-548n	CLIP-seq
MIRT1389507	hsa-miR-548p	CLIP-seq
MIRT1389539	hsa-miR-548t	CLIP-seq
MIRT1389540	hsa-miR-548u	CLIP-seq
MIRT1389541	hsa-miR-549	CLIP-seq
MIRT1389542	hsa-miR-584	CLIP-seq
MIRT1389512	hsa-miR-641	CLIP-seq
MIRT1389543	hsa-miR-656	CLIP-seq
MIRT1389513	hsa-miR-875-5p	CLIP-seq
MIRT2116719	hsa-miR-3688-3p	CLIP-seq
MIRT2116720	hsa-miR-3163	CLIP-seq
MIRT1389484	hsa-miR-330-3p	CLIP-seq
MIRT2116721	hsa-miR-3668	CLIP-seq
MIRT2116722	hsa-miR-374a	CLIP-seq
MIRT2116723	hsa-miR-374b	CLIP-seq
MIRT2116724	hsa-miR-3924	CLIP-seq
MIRT1389484	hsa-miR-330-3p	CLIP-seq
MIRT2116721	hsa-miR-3668	CLIP-seq
MIRT1389503	hsa-miR-520d-5p	CLIP-seq
MIRT1389504	hsa-miR-524-5p	CLIP-seq
MIRT2339116	hsa-miR-3613-5p	CLIP-seq
MIRT2116719	hsa-miR-3688-3p	CLIP-seq
MIRT2339117	hsa-miR-513b	CLIP-seq
MIRT2440801	hsa-miR-377	CLIP-seq
MIRT2440802	hsa-miR-4731-3p	CLIP-seq
MIRT2440803	hsa-miR-4801	CLIP-seq
MIRT2632791	hsa-miR-1	CLIP-seq
MIRT2632792	hsa-miR-1273d	CLIP-seq
MIRT1389464	hsa-miR-128	CLIP-seq
MIRT1389465	hsa-miR-1283	CLIP-seq
MIRT2632793	hsa-miR-1288	CLIP-seq
MIRT2632794	hsa-miR-1289	CLIP-seq
MIRT2632795	hsa-miR-1303	CLIP-seq
MIRT2632796	hsa-miR-1323	CLIP-seq
MIRT1389468	hsa-miR-148a	CLIP-seq
MIRT1389469	hsa-miR-148b	CLIP-seq
MIRT1389470	hsa-miR-152	CLIP-seq
MIRT1389471	hsa-miR-181a	CLIP-seq
MIRT1389472	hsa-miR-181b	CLIP-seq
MIRT1389473	hsa-miR-181c	CLIP-seq
MIRT1389474	hsa-miR-181d	CLIP-seq
MIRT2632797	hsa-miR-1912	CLIP-seq
MIRT2632798	hsa-miR-19a	CLIP-seq
MIRT2632799	hsa-miR-19b	CLIP-seq
MIRT2632800	hsa-miR-206	CLIP-seq
MIRT1389476	hsa-miR-221	CLIP-seq
MIRT1389477	hsa-miR-222	CLIP-seq
MIRT1389519	hsa-miR-2355-5p	CLIP-seq
MIRT1389520	hsa-miR-23a	CLIP-seq
MIRT1389521	hsa-miR-23b	CLIP-seq
MIRT1389522	hsa-miR-23c	CLIP-seq
MIRT1389478	hsa-miR-27a	CLIP-seq
MIRT1389479	hsa-miR-27b	CLIP-seq
MIRT1389523	hsa-miR-302f	CLIP-seq
MIRT1389481	hsa-miR-3144-3p	CLIP-seq
MIRT1389525	hsa-miR-3149	CLIP-seq
MIRT2632801	hsa-miR-3180-5p	CLIP-seq
MIRT1389483	hsa-miR-3189-3p	CLIP-seq
MIRT2632802	hsa-miR-3198	CLIP-seq
MIRT2632803	hsa-miR-3199	CLIP-seq
MIRT1389484	hsa-miR-330-3p	CLIP-seq
MIRT2632804	hsa-miR-3612	CLIP-seq
MIRT2632805	hsa-miR-3618	CLIP-seq
MIRT2632806	hsa-miR-3673	CLIP-seq
MIRT2116719	hsa-miR-3688-3p	CLIP-seq
MIRT2632807	hsa-miR-3690	CLIP-seq
MIRT2632808	hsa-miR-3713	CLIP-seq
MIRT2116722	hsa-miR-374a	CLIP-seq
MIRT2116723	hsa-miR-374b	CLIP-seq
MIRT2440801	hsa-miR-377	CLIP-seq
MIRT2632809	hsa-miR-3913-3p	CLIP-seq
MIRT1389488	hsa-miR-3975	CLIP-seq
MIRT2632810	hsa-miR-4254	CLIP-seq
MIRT1389489	hsa-miR-4262	CLIP-seq
MIRT2632811	hsa-miR-4294	CLIP-seq
MIRT2632812	hsa-miR-4309	CLIP-seq
MIRT1389490	hsa-miR-432	CLIP-seq
MIRT2632813	hsa-miR-4477b	CLIP-seq
MIRT2632814	hsa-miR-448	CLIP-seq
MIRT2632815	hsa-miR-4668-3p	CLIP-seq
MIRT2632816	hsa-miR-4695-5p	CLIP-seq
MIRT1389495	hsa-miR-4698	CLIP-seq
MIRT2632817	hsa-miR-4719	CLIP-seq
MIRT2440802	hsa-miR-4731-3p	CLIP-seq
MIRT1389532	hsa-miR-4774-3p	CLIP-seq
MIRT2632818	hsa-miR-4775	CLIP-seq
MIRT1389533	hsa-miR-4778-3p	CLIP-seq
MIRT1389499	hsa-miR-4799-5p	CLIP-seq
MIRT2440803	hsa-miR-4801	CLIP-seq
MIRT2632819	hsa-miR-489	CLIP-seq
MIRT2632820	hsa-miR-494	CLIP-seq
MIRT2632821	hsa-miR-507	CLIP-seq
MIRT2632822	hsa-miR-518a-5p	CLIP-seq
MIRT2632823	hsa-miR-520a-5p	CLIP-seq
MIRT1389503	hsa-miR-520d-5p	CLIP-seq
MIRT2632824	hsa-miR-522	CLIP-seq
MIRT1389504	hsa-miR-524-5p	CLIP-seq
MIRT2632825	hsa-miR-525-5p	CLIP-seq
MIRT2632826	hsa-miR-527	CLIP-seq
MIRT2632827	hsa-miR-539	CLIP-seq
MIRT2632828	hsa-miR-548a-3p	CLIP-seq
MIRT2632829	hsa-miR-548e	CLIP-seq
MIRT2632830	hsa-miR-548f	CLIP-seq
MIRT2632831	hsa-miR-548g	CLIP-seq
MIRT1389537	hsa-miR-548k	CLIP-seq
MIRT1389538	hsa-miR-548n	CLIP-seq
MIRT2632832	hsa-miR-548o	CLIP-seq
MIRT1389507	hsa-miR-548p	CLIP-seq
MIRT1389539	hsa-miR-548t	CLIP-seq
MIRT1389540	hsa-miR-548u	CLIP-seq
MIRT2632833	hsa-miR-557	CLIP-seq
MIRT2632834	hsa-miR-561	CLIP-seq
MIRT1389509	hsa-miR-583	CLIP-seq
MIRT1389542	hsa-miR-584	CLIP-seq
MIRT2632835	hsa-miR-590-3p	CLIP-seq
MIRT2632836	hsa-miR-606	CLIP-seq
MIRT2632837	hsa-miR-613	CLIP-seq
MIRT1389510	hsa-miR-617	CLIP-seq
MIRT2632838	hsa-miR-650	CLIP-seq
MIRT1389543	hsa-miR-656	CLIP-seq
MIRT1389513	hsa-miR-875-5p	CLIP-seq
MIRT2632839	hsa-miR-892a	CLIP-seq
MIRT2632791	hsa-miR-1	CLIP-seq
MIRT2632792	hsa-miR-1273d	CLIP-seq
MIRT1389464	hsa-miR-128	CLIP-seq
MIRT1389465	hsa-miR-1283	CLIP-seq
MIRT2632793	hsa-miR-1288	CLIP-seq
MIRT2632794	hsa-miR-1289	CLIP-seq
MIRT2632795	hsa-miR-1303	CLIP-seq
MIRT2632796	hsa-miR-1323	CLIP-seq
MIRT1389468	hsa-miR-148a	CLIP-seq
MIRT1389469	hsa-miR-148b	CLIP-seq
MIRT1389470	hsa-miR-152	CLIP-seq
MIRT1389471	hsa-miR-181a	CLIP-seq
MIRT1389472	hsa-miR-181b	CLIP-seq
MIRT1389473	hsa-miR-181c	CLIP-seq
MIRT1389474	hsa-miR-181d	CLIP-seq
MIRT2632797	hsa-miR-1912	CLIP-seq
MIRT2632798	hsa-miR-19a	CLIP-seq
MIRT2632799	hsa-miR-19b	CLIP-seq
MIRT2632800	hsa-miR-206	CLIP-seq
MIRT1389519	hsa-miR-2355-5p	CLIP-seq
MIRT1389520	hsa-miR-23a	CLIP-seq
MIRT1389521	hsa-miR-23b	CLIP-seq
MIRT1389522	hsa-miR-23c	CLIP-seq
MIRT1389478	hsa-miR-27a	CLIP-seq
MIRT1389479	hsa-miR-27b	CLIP-seq
MIRT1389523	hsa-miR-302f	CLIP-seq
MIRT1389481	hsa-miR-3144-3p	CLIP-seq
MIRT1389525	hsa-miR-3149	CLIP-seq
MIRT2632801	hsa-miR-3180-5p	CLIP-seq
MIRT1389483	hsa-miR-3189-3p	CLIP-seq
MIRT2632802	hsa-miR-3198	CLIP-seq
MIRT2632803	hsa-miR-3199	CLIP-seq
MIRT2632805	hsa-miR-3618	CLIP-seq
MIRT2632806	hsa-miR-3673	CLIP-seq
MIRT2116719	hsa-miR-3688-3p	CLIP-seq
MIRT2632807	hsa-miR-3690	CLIP-seq
MIRT2632808	hsa-miR-3713	CLIP-seq
MIRT2116722	hsa-miR-374a	CLIP-seq
MIRT2116723	hsa-miR-374b	CLIP-seq
MIRT2440801	hsa-miR-377	CLIP-seq
MIRT2632809	hsa-miR-3913-3p	CLIP-seq
MIRT1389488	hsa-miR-3975	CLIP-seq
MIRT2632810	hsa-miR-4254	CLIP-seq
MIRT1389489	hsa-miR-4262	CLIP-seq
MIRT2632811	hsa-miR-4294	CLIP-seq
MIRT2632812	hsa-miR-4309	CLIP-seq
MIRT1389490	hsa-miR-432	CLIP-seq
MIRT2632813	hsa-miR-4477b	CLIP-seq
MIRT2632814	hsa-miR-448	CLIP-seq
MIRT2632815	hsa-miR-4668-3p	CLIP-seq
MIRT1389495	hsa-miR-4698	CLIP-seq
MIRT2632817	hsa-miR-4719	CLIP-seq
MIRT2440802	hsa-miR-4731-3p	CLIP-seq
MIRT1389532	hsa-miR-4774-3p	CLIP-seq
MIRT2632818	hsa-miR-4775	CLIP-seq
MIRT1389533	hsa-miR-4778-3p	CLIP-seq
MIRT1389499	hsa-miR-4799-5p	CLIP-seq
MIRT2440803	hsa-miR-4801	CLIP-seq
MIRT2632819	hsa-miR-489	CLIP-seq
MIRT2632821	hsa-miR-507	CLIP-seq
MIRT2632823	hsa-miR-520a-5p	CLIP-seq
MIRT2632824	hsa-miR-522	CLIP-seq
MIRT2632825	hsa-miR-525-5p	CLIP-seq
MIRT2632828	hsa-miR-548a-3p	CLIP-seq
MIRT2632829	hsa-miR-548e	CLIP-seq
MIRT2632830	hsa-miR-548f	CLIP-seq
MIRT2632831	hsa-miR-548g	CLIP-seq
MIRT1389537	hsa-miR-548k	CLIP-seq
MIRT1389538	hsa-miR-548n	CLIP-seq
MIRT2632832	hsa-miR-548o	CLIP-seq
MIRT1389507	hsa-miR-548p	CLIP-seq
MIRT1389539	hsa-miR-548t	CLIP-seq
MIRT1389540	hsa-miR-548u	CLIP-seq
MIRT2632833	hsa-miR-557	CLIP-seq
MIRT2632834	hsa-miR-561	CLIP-seq
MIRT1389509	hsa-miR-583	CLIP-seq
MIRT1389542	hsa-miR-584	CLIP-seq
MIRT2632835	hsa-miR-590-3p	CLIP-seq
MIRT2632836	hsa-miR-606	CLIP-seq
MIRT2632837	hsa-miR-613	CLIP-seq
MIRT1389510	hsa-miR-617	CLIP-seq
MIRT1389543	hsa-miR-656	CLIP-seq
MIRT1389513	hsa-miR-875-5p	CLIP-seq
MIRT2632839	hsa-miR-892a	CLIP-seq

Show/Hide all (59)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000245	Process	Spliceosomal complex assembly	IBA
GO:0000245	Process	Spliceosomal complex assembly	IDA	9472028
GO:0000245	Process	Spliceosomal complex assembly	IEA
GO:0000287	Function	Magnesium ion binding	IDA	9472028
GO:0000287	Function	Magnesium ion binding	IEA
GO:0000785	Component	Chromatin	IDA	28076779
GO:0001525	Process	Angiogenesis	ISS
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	9472028
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IGI	26167880
GO:0005515	Function	Protein binding	IPI	16189514, 19592491, 22365833, 23602568, 25416956, 28076779, 32296183, 32707033, 32817937, 33961781, 34578187, 35271311, 37207277, 39251607
GO:0005524	Function	ATP binding	IDA	9472028
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	9472028
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	28076779
GO:0005654	Component	Nucleoplasm	IEA
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	9472028, 28076779
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006397	Process	MRNA processing	IEA
GO:0006468	Process	Protein phosphorylation	IDA	9472028
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	18559500
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008380	Process	RNA splicing	IDA	9472028
GO:0008380	Process	RNA splicing	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016607	Component	Nuclear speck	IDA	28076779
GO:0016607	Component	Nuclear speck	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0018105	Process	Peptidyl-serine phosphorylation	IGI	26167880
GO:0030154	Process	Cell differentiation	IEA
GO:0035063	Process	Nuclear speck organization	ISS
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	IDA	9472028
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0043491	Process	Phosphatidylinositol 3-kinase/protein kinase B signal transduction	ISS
GO:0043525	Process	Positive regulation of neuron apoptotic process	ISS
GO:0045070	Process	Positive regulation of viral genome replication	IDA	20498328
GO:0045071	Process	Negative regulation of viral genome replication	IDA	12417631
GO:0045087	Process	Innate immune response	IC	12417631
GO:0045787	Process	Positive regulation of cell cycle	ISS
GO:0048024	Process	Regulation of mRNA splicing, via spliceosome	TAS	21205200
GO:0050684	Process	Regulation of mRNA processing	IBA
GO:0062176	Process	R-loop processing	IDA	28076779
GO:0071889	Function	14-3-3 protein binding	ISS
GO:0098793	Component	Presynapse	IEA
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
602980	11306	ENSG00000135250

P78362

Protein name

SRSF protein kinase 2 (EC 2.7.11.1) (SFRS protein kinase 2) (Serine/arginine-rich protein-specific kinase 2) (SR-protein-specific kinase 2) [Cleaved into: SRSF protein kinase 2 N-terminal; SRSF protein kinase 2 C-terminal]

Protein function

Serine/arginine-rich protein-specific kinase which specifically phosphorylates its substrates at serine residues located in regions rich in arginine/serine dipeptides, known as RS domains and is involved in the phosphorylation of SR splicing fac

PDB

2X7G , 5MYV , 7ZKX

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	81 → 230	Protein kinase domain	Domain
PF00069	Pkinase	511 → 686	Protein kinase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in brain, moderately expressed in heart and skeletal muscle and at low levels in lung, liver, and kidney. {ECO:0000269|PubMed:9472028}.

Sequence

MSVNSEKSSSSERPEPQQKAPLVPPPPPPPPPPPPPLPDPTPPEPEEEILGSDDEEQEDP
ADYCKGGYHPVKIGDLFNGRYHVIRKLGWGHFSTVWLCWDMQGKRFVAMKVVKSAQHYTE
TALDEIKLLKCVRESDPSDPNKDMVVQLIDDFKISGMNGIHVCMVFEVLGHHLLKWIIKS
NYQGLPVRCVKSIIRQVLQGLDYLHSKCKIIHTDIKPENILMCVDDAYVRRMAAEATEWQ
KAGAPPPSGSAVSTAPQQKPIGKISKNKKKKLKKKQKRQAELLEKRLQEIEELEREAERK
IIEENITSAAPSNDQDGEYCPEVKLKTTGLEEAAEAETAKDNGEAEDQEEKEDAEKENIE
KDEDDVDQELANIDPTWIESPKTNGHIENGPFSLEQQLDDEDDDEEDCPNPEEYNLDEPN
AESDYTYSSSYEQFNGELPNGRHKIPESQFPEFSTSLFSGSLEPVACGSVLSEGSPLTEQ
EESSPSHDRSRTVSASSTGDLPKAKTRAADLLVNPLDPRNADKIRVKIADLGNACWVHKH
FTEDIQTRQYRSIEVLIGAGYSTPADIWSTACMAFELATGDYLFEPHSGEDYSRDEDHIA
HIIELLGSIPRHFALSGKYSREFFNRRGELRHITKLKPWSLFDVLVEKYGWPHEDAAQFT
DFLIPMLEMVPEKRASAGECLRHPWLNS

Sequence length

688

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (23)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATROPHIC MACULAR DEGENERATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELANOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SRPK2-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WET MACULAR DEGENERATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (44)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23071587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	GWASCAT_DG	26691988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	37907504	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	23071587	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30970615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Child Development Disorders, Pervasive	Development Disorder	GWASCAT_DG	28540026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	39344395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	27041240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31898732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epithelial ovarian cancer	Ovarian cancer	BEFREE	30970615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	GWASCAT_DG	26691988		★★★★★ ★☆☆☆☆ Found in Text Mining only
exudative macular degeneration	Exudative macular degeneration	GWASCAT_DG	26691988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	GWASCAT_DG	26691988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	23197718, 30373880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	31103287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	18559500, 26244849		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	18559500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	18559500, 26244849	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	18559500	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28895405		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30724469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29587239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29587239, 30724469, 31229549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	27041240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	31043756		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29153836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopia, Degenerative	Myopia	GWASCAT_DG	23049088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32671994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27041240, 29587239, 30724469, 31833327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23071587, 31833327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30724469		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30724469, 31898732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29587239		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASCAT_DG	25056061, 26198764, 28540026, 28991256, 29483656, 30285260, 31268507		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma	Scleroderma	BEFREE	12417631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26853621	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23071587		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	26853621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	12417631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	30373880		★★★★★ ★☆☆☆☆ Found in Text Mining only

SRPK2 (SRSF protein kinase 2)