SRF (serum response factor)

Gene

• Entrez ID: 6722
• Gene name: Serum response factor
• Gene symbol: SRF
• Synonyms (NCBI Gene): MCM1
• Chromosome: 6
• Chromosome location: 6p21.1
• Summary: This gene encodes a ubiquitous nuclear protein that stimulates both cell proliferation and differentiation. It is a member of the MADS (MCM1, Agamous, Deficiens, and SRF) box superfamily of transcription factors. This protein binds to the serum response e

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000365	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR, Western blot	19726678
MIRT000365	hsa-miR-122-5p	Luciferase reporter assay, qRT-PCR, Western blot	19726678
MIRT006153	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR, Western blot	21893058
MIRT006153	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR, Western blot	21893058
MIRT006153	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR, Western blot	21893058
MIRT006153	hsa-miR-483-5p	Luciferase reporter assay, qRT-PCR, Western blot	21893058
MIRT006833	hsa-miR-9-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	22907787
MIRT006834	hsa-miR-200a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22907787
MIRT006834	hsa-miR-200a-3p	Immunoblot, Luciferase reporter assay, qRT-PCR	22907787
MIRT023547	hsa-miR-1-3p	Western blot	20458751
MIRT028897	hsa-miR-26b-5p	Microarray	19088304
MIRT049829	hsa-miR-92a-3p	CLASH	23622248
MIRT044832	hsa-miR-320a	CLASH	23622248
MIRT043424	hsa-miR-331-3p	CLASH	23622248
MIRT042926	hsa-miR-324-3p	CLASH	23622248
MIRT041943	hsa-miR-484	CLASH	23622248
MIRT040918	hsa-miR-18a-3p	CLASH	23622248
MIRT719474	hsa-miR-4640-3p	HITS-CLIP	19536157
MIRT719473	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT719472	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT719471	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT719470	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT719469	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT719468	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT719467	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT719466	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT719465	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT719464	hsa-miR-6802-3p	HITS-CLIP	19536157
MIRT719463	hsa-miR-1229-3p	HITS-CLIP	19536157
MIRT719462	hsa-miR-3074-5p	HITS-CLIP	19536157
MIRT719461	hsa-miR-6804-3p	HITS-CLIP	19536157
MIRT733573	hsa-miR-330-5p	Luciferase reporter assay, RNA-seq	31967986
MIRT733573	hsa-miR-330-5p	Luciferase reporter assay, RNA-seq	31967986
MIRT719474	hsa-miR-4640-3p	HITS-CLIP	19536157
MIRT719473	hsa-miR-4722-3p	HITS-CLIP	19536157
MIRT719472	hsa-miR-6727-3p	HITS-CLIP	19536157
MIRT719471	hsa-miR-6747-3p	HITS-CLIP	19536157
MIRT719470	hsa-miR-6511a-3p	HITS-CLIP	19536157
MIRT719469	hsa-miR-6511b-3p	HITS-CLIP	19536157
MIRT719468	hsa-miR-6784-3p	HITS-CLIP	19536157
MIRT719467	hsa-miR-6862-3p	HITS-CLIP	19536157
MIRT719466	hsa-miR-2682-3p	HITS-CLIP	19536157
MIRT719465	hsa-miR-6781-3p	HITS-CLIP	19536157
MIRT719464	hsa-miR-6802-3p	HITS-CLIP	19536157
MIRT719463	hsa-miR-1229-3p	HITS-CLIP	19536157
MIRT719462	hsa-miR-3074-5p	HITS-CLIP	19536157
MIRT719461	hsa-miR-6804-3p	HITS-CLIP	19536157
MIRT755749	hsa-miR-423-5p	Luciferase reporter assay, Western blotting, qRT-PCR, ELISA	38790235
MIRT1388307	hsa-miR-101	CLIP-seq
MIRT1388308	hsa-miR-1178	CLIP-seq
MIRT1388309	hsa-miR-1254	CLIP-seq
MIRT1388310	hsa-miR-1275	CLIP-seq
MIRT1388311	hsa-miR-1285	CLIP-seq
MIRT1388312	hsa-miR-1302	CLIP-seq
MIRT1388313	hsa-miR-142-5p	CLIP-seq
MIRT1388314	hsa-miR-144	CLIP-seq
MIRT1388315	hsa-miR-148a	CLIP-seq
MIRT1388316	hsa-miR-148b	CLIP-seq
MIRT1388317	hsa-miR-150	CLIP-seq
MIRT1388318	hsa-miR-152	CLIP-seq
MIRT1388319	hsa-miR-1825	CLIP-seq
MIRT1388320	hsa-miR-193a-5p	CLIP-seq
MIRT1388321	hsa-miR-1976	CLIP-seq
MIRT1388322	hsa-miR-200b	CLIP-seq
MIRT1388323	hsa-miR-200c	CLIP-seq
MIRT1388324	hsa-miR-2113	CLIP-seq
MIRT1388325	hsa-miR-22	CLIP-seq
MIRT1388326	hsa-miR-2277-3p	CLIP-seq
MIRT1388327	hsa-miR-296-5p	CLIP-seq
MIRT1388328	hsa-miR-31	CLIP-seq
MIRT1388329	hsa-miR-3116	CLIP-seq
MIRT1388330	hsa-miR-3120-3p	CLIP-seq
MIRT1388331	hsa-miR-3120-5p	CLIP-seq
MIRT1388332	hsa-miR-3125	CLIP-seq
MIRT1388333	hsa-miR-3150a-3p	CLIP-seq
MIRT1388334	hsa-miR-3152-5p	CLIP-seq
MIRT1388335	hsa-miR-3160-5p	CLIP-seq
MIRT1388336	hsa-miR-3174	CLIP-seq
MIRT1388337	hsa-miR-3187-5p	CLIP-seq
MIRT1388338	hsa-miR-329	CLIP-seq
MIRT1388339	hsa-miR-342-3p	CLIP-seq
MIRT1388340	hsa-miR-3616-3p	CLIP-seq
MIRT1388341	hsa-miR-362-3p	CLIP-seq
MIRT1388342	hsa-miR-3671	CLIP-seq
MIRT1388343	hsa-miR-3680	CLIP-seq
MIRT1388344	hsa-miR-377	CLIP-seq
MIRT1388345	hsa-miR-3908	CLIP-seq
MIRT1388346	hsa-miR-3909	CLIP-seq
MIRT1388347	hsa-miR-3916	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT1388349	hsa-miR-3928	CLIP-seq
MIRT1388350	hsa-miR-3937	CLIP-seq
MIRT1388351	hsa-miR-4265	CLIP-seq
MIRT1388352	hsa-miR-4279	CLIP-seq
MIRT1388353	hsa-miR-429	CLIP-seq
MIRT1388354	hsa-miR-4292	CLIP-seq
MIRT1388355	hsa-miR-4296	CLIP-seq
MIRT1388356	hsa-miR-4298	CLIP-seq
MIRT1388357	hsa-miR-4308	CLIP-seq
MIRT1388358	hsa-miR-4322	CLIP-seq
MIRT1388359	hsa-miR-4428	CLIP-seq
MIRT1388360	hsa-miR-4433	CLIP-seq
MIRT1388361	hsa-miR-4447	CLIP-seq
MIRT1388362	hsa-miR-4472	CLIP-seq
MIRT1388363	hsa-miR-4481	CLIP-seq
MIRT1388364	hsa-miR-4492	CLIP-seq
MIRT1388365	hsa-miR-4498	CLIP-seq
MIRT1388366	hsa-miR-4505	CLIP-seq
MIRT1388367	hsa-miR-4525	CLIP-seq
MIRT1388368	hsa-miR-4528	CLIP-seq
MIRT1388369	hsa-miR-4533	CLIP-seq
MIRT1388370	hsa-miR-4648	CLIP-seq
MIRT1388371	hsa-miR-4654	CLIP-seq
MIRT1388372	hsa-miR-4659a-3p	CLIP-seq
MIRT1388373	hsa-miR-4659b-3p	CLIP-seq
MIRT1388374	hsa-miR-4665-5p	CLIP-seq
MIRT1388375	hsa-miR-4696	CLIP-seq
MIRT1388376	hsa-miR-4698	CLIP-seq
MIRT1388377	hsa-miR-4707-5p	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT1388379	hsa-miR-4721	CLIP-seq
MIRT1388380	hsa-miR-4745-5p	CLIP-seq
MIRT1388381	hsa-miR-4747-5p	CLIP-seq
MIRT1388382	hsa-miR-4749-3p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT1388384	hsa-miR-4760-3p	CLIP-seq
MIRT1388385	hsa-miR-4765	CLIP-seq
MIRT1388386	hsa-miR-4769-5p	CLIP-seq
MIRT1388387	hsa-miR-4774-3p	CLIP-seq
MIRT1388388	hsa-miR-4775	CLIP-seq
MIRT1388389	hsa-miR-4789-3p	CLIP-seq
MIRT1388390	hsa-miR-491-5p	CLIP-seq
MIRT1388391	hsa-miR-5096	CLIP-seq
MIRT1388392	hsa-miR-510	CLIP-seq
MIRT1388393	hsa-miR-511	CLIP-seq
MIRT1388394	hsa-miR-548an	CLIP-seq
MIRT1388395	hsa-miR-548c-3p	CLIP-seq
MIRT1388396	hsa-miR-574-3p	CLIP-seq
MIRT1388397	hsa-miR-582-5p	CLIP-seq
MIRT1388398	hsa-miR-612	CLIP-seq
MIRT1388399	hsa-miR-625	CLIP-seq
MIRT1388400	hsa-miR-661	CLIP-seq
MIRT1388401	hsa-miR-708	CLIP-seq
MIRT1388402	hsa-miR-762	CLIP-seq
MIRT1388403	hsa-miR-767-3p	CLIP-seq
MIRT1388404	hsa-miR-877	CLIP-seq
MIRT1388405	hsa-miR-935	CLIP-seq
MIRT1388406	hsa-miR-939	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT1388308	hsa-miR-1178	CLIP-seq
MIRT2116298	hsa-miR-1197	CLIP-seq
MIRT2116299	hsa-miR-1207-5p	CLIP-seq
MIRT2116300	hsa-miR-1224-3p	CLIP-seq
MIRT2116301	hsa-miR-1225-5p	CLIP-seq
MIRT2116302	hsa-miR-1229	CLIP-seq
MIRT2116303	hsa-miR-125a-5p	CLIP-seq
MIRT2116304	hsa-miR-125b	CLIP-seq
MIRT2116305	hsa-miR-1260	CLIP-seq
MIRT2116306	hsa-miR-1260b	CLIP-seq
MIRT2116307	hsa-miR-1280	CLIP-seq
MIRT2116308	hsa-miR-1281	CLIP-seq
MIRT2116309	hsa-miR-1343	CLIP-seq
MIRT2116310	hsa-miR-1470	CLIP-seq
MIRT1388317	hsa-miR-150	CLIP-seq
MIRT2116311	hsa-miR-1539	CLIP-seq
MIRT2116312	hsa-miR-186	CLIP-seq
MIRT2116313	hsa-miR-188-5p	CLIP-seq
MIRT2116314	hsa-miR-1915	CLIP-seq
MIRT1388320	hsa-miR-193a-5p	CLIP-seq
MIRT1388321	hsa-miR-1976	CLIP-seq
MIRT1388322	hsa-miR-200b	CLIP-seq
MIRT1388323	hsa-miR-200c	CLIP-seq
MIRT1388324	hsa-miR-2113	CLIP-seq
MIRT2116315	hsa-miR-2115	CLIP-seq
MIRT2116316	hsa-miR-223	CLIP-seq
MIRT1388327	hsa-miR-296-5p	CLIP-seq
MIRT1388328	hsa-miR-31	CLIP-seq
MIRT1388331	hsa-miR-3120-5p	CLIP-seq
MIRT1388332	hsa-miR-3125	CLIP-seq
MIRT2116317	hsa-miR-3133	CLIP-seq
MIRT1388333	hsa-miR-3150a-3p	CLIP-seq
MIRT2116318	hsa-miR-3151	CLIP-seq
MIRT1388334	hsa-miR-3152-5p	CLIP-seq
MIRT2116319	hsa-miR-3163	CLIP-seq
MIRT2116320	hsa-miR-3169	CLIP-seq
MIRT2116321	hsa-miR-3184	CLIP-seq
MIRT2116322	hsa-miR-3193	CLIP-seq
MIRT2116323	hsa-miR-324-5p	CLIP-seq
MIRT1388339	hsa-miR-342-3p	CLIP-seq
MIRT1388340	hsa-miR-3616-3p	CLIP-seq
MIRT2116324	hsa-miR-3646	CLIP-seq
MIRT2116325	hsa-miR-3661	CLIP-seq
MIRT1388342	hsa-miR-3671	CLIP-seq
MIRT1388343	hsa-miR-3680	CLIP-seq
MIRT2116326	hsa-miR-3688-5p	CLIP-seq
MIRT2116327	hsa-miR-3689d	CLIP-seq
MIRT2116328	hsa-miR-3714	CLIP-seq
MIRT1388344	hsa-miR-377	CLIP-seq
MIRT1388346	hsa-miR-3909	CLIP-seq
MIRT1388347	hsa-miR-3916	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT1388350	hsa-miR-3937	CLIP-seq
MIRT755749	hsa-miR-423-5p	CLIP-seq
MIRT2116329	hsa-miR-4257	CLIP-seq
MIRT1388351	hsa-miR-4265	CLIP-seq
MIRT1388352	hsa-miR-4279	CLIP-seq
MIRT1388353	hsa-miR-429	CLIP-seq
MIRT2116330	hsa-miR-4290	CLIP-seq
MIRT1388355	hsa-miR-4296	CLIP-seq
MIRT1388357	hsa-miR-4308	CLIP-seq
MIRT2116331	hsa-miR-4310	CLIP-seq
MIRT2116332	hsa-miR-4313	CLIP-seq
MIRT2116333	hsa-miR-4319	CLIP-seq
MIRT1388358	hsa-miR-4322	CLIP-seq
MIRT2116334	hsa-miR-4323	CLIP-seq
MIRT2116335	hsa-miR-4423-5p	CLIP-seq
MIRT1388359	hsa-miR-4428	CLIP-seq
MIRT1388360	hsa-miR-4433	CLIP-seq
MIRT2116336	hsa-miR-4436b-3p	CLIP-seq
MIRT2116337	hsa-miR-4446-3p	CLIP-seq
MIRT2116338	hsa-miR-4462	CLIP-seq
MIRT2116339	hsa-miR-4469	CLIP-seq
MIRT2116340	hsa-miR-4470	CLIP-seq
MIRT2116341	hsa-miR-4493	CLIP-seq
MIRT1388368	hsa-miR-4528	CLIP-seq
MIRT1388369	hsa-miR-4533	CLIP-seq
MIRT2116342	hsa-miR-4641	CLIP-seq
MIRT1388370	hsa-miR-4648	CLIP-seq
MIRT1388371	hsa-miR-4654	CLIP-seq
MIRT2116343	hsa-miR-4656	CLIP-seq
MIRT2116344	hsa-miR-4667-3p	CLIP-seq
MIRT2116345	hsa-miR-4668-3p	CLIP-seq
MIRT2116346	hsa-miR-4685-5p	CLIP-seq
MIRT2116347	hsa-miR-4688	CLIP-seq
MIRT1388376	hsa-miR-4698	CLIP-seq
MIRT2116348	hsa-miR-4708-3p	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT2116349	hsa-miR-4719	CLIP-seq
MIRT1388379	hsa-miR-4721	CLIP-seq
MIRT2116350	hsa-miR-4726-3p	CLIP-seq
MIRT2116351	hsa-miR-4728-5p	CLIP-seq
MIRT2116352	hsa-miR-4746-5p	CLIP-seq
MIRT1388381	hsa-miR-4747-5p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT2116353	hsa-miR-4758-3p	CLIP-seq
MIRT1388384	hsa-miR-4760-3p	CLIP-seq
MIRT2116354	hsa-miR-4763-3p	CLIP-seq
MIRT1388386	hsa-miR-4769-5p	CLIP-seq
MIRT1388387	hsa-miR-4774-3p	CLIP-seq
MIRT2116355	hsa-miR-4780	CLIP-seq
MIRT2116356	hsa-miR-486-3p	CLIP-seq
MIRT1388390	hsa-miR-491-5p	CLIP-seq
MIRT1388391	hsa-miR-5096	CLIP-seq
MIRT1388392	hsa-miR-510	CLIP-seq
MIRT1388393	hsa-miR-511	CLIP-seq
MIRT2116357	hsa-miR-516a-3p	CLIP-seq
MIRT2116358	hsa-miR-532-3p	CLIP-seq
MIRT2116359	hsa-miR-544b	CLIP-seq
MIRT2116360	hsa-miR-555	CLIP-seq
MIRT2116361	hsa-miR-564	CLIP-seq
MIRT1388396	hsa-miR-574-3p	CLIP-seq
MIRT2116362	hsa-miR-631	CLIP-seq
MIRT2116363	hsa-miR-635	CLIP-seq
MIRT2116364	hsa-miR-642a	CLIP-seq
MIRT2116365	hsa-miR-642b	CLIP-seq
MIRT2116366	hsa-miR-644	CLIP-seq
MIRT2116367	hsa-miR-647	CLIP-seq
MIRT1388401	hsa-miR-708	CLIP-seq
MIRT1388403	hsa-miR-767-3p	CLIP-seq
MIRT1388406	hsa-miR-939	CLIP-seq
MIRT1388308	hsa-miR-1178	CLIP-seq
MIRT2116300	hsa-miR-1224-3p	CLIP-seq
MIRT2116305	hsa-miR-1260	CLIP-seq
MIRT2116306	hsa-miR-1260b	CLIP-seq
MIRT2116307	hsa-miR-1280	CLIP-seq
MIRT1388313	hsa-miR-142-5p	CLIP-seq
MIRT2338869	hsa-miR-146a	CLIP-seq
MIRT2338870	hsa-miR-146b-5p	CLIP-seq
MIRT2338871	hsa-miR-149	CLIP-seq
MIRT1388317	hsa-miR-150	CLIP-seq
MIRT2116314	hsa-miR-1915	CLIP-seq
MIRT2338872	hsa-miR-3064-5p	CLIP-seq
MIRT2338873	hsa-miR-3119	CLIP-seq
MIRT2338874	hsa-miR-3127-3p	CLIP-seq
MIRT1388334	hsa-miR-3152-5p	CLIP-seq
MIRT2338875	hsa-miR-3173-3p	CLIP-seq
MIRT2338876	hsa-miR-3189-5p	CLIP-seq
MIRT2338877	hsa-miR-3192	CLIP-seq
MIRT2338878	hsa-miR-3202	CLIP-seq
MIRT1388338	hsa-miR-329	CLIP-seq
MIRT1388339	hsa-miR-342-3p	CLIP-seq
MIRT2338879	hsa-miR-34b	CLIP-seq
MIRT1388340	hsa-miR-3616-3p	CLIP-seq
MIRT1388341	hsa-miR-362-3p	CLIP-seq
MIRT2116324	hsa-miR-3646	CLIP-seq
MIRT1388343	hsa-miR-3680	CLIP-seq
MIRT2116326	hsa-miR-3688-5p	CLIP-seq
MIRT2116328	hsa-miR-3714	CLIP-seq
MIRT2338880	hsa-miR-371-5p	CLIP-seq
MIRT2338881	hsa-miR-371b-5p	CLIP-seq
MIRT1388344	hsa-miR-377	CLIP-seq
MIRT1388345	hsa-miR-3908	CLIP-seq
MIRT1388346	hsa-miR-3909	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT1388349	hsa-miR-3928	CLIP-seq
MIRT2338882	hsa-miR-4271	CLIP-seq
MIRT2338883	hsa-miR-4278	CLIP-seq
MIRT2116330	hsa-miR-4290	CLIP-seq
MIRT1388354	hsa-miR-4292	CLIP-seq
MIRT1388357	hsa-miR-4308	CLIP-seq
MIRT2338884	hsa-miR-4326	CLIP-seq
MIRT1388360	hsa-miR-4433	CLIP-seq
MIRT2116340	hsa-miR-4470	CLIP-seq
MIRT2338885	hsa-miR-4476	CLIP-seq
MIRT1388368	hsa-miR-4528	CLIP-seq
MIRT1388369	hsa-miR-4533	CLIP-seq
MIRT2116342	hsa-miR-4641	CLIP-seq
MIRT2338886	hsa-miR-4659a-5p	CLIP-seq
MIRT2338887	hsa-miR-4659b-5p	CLIP-seq
MIRT2338888	hsa-miR-4676-5p	CLIP-seq
MIRT2338889	hsa-miR-4691-5p	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT2116349	hsa-miR-4719	CLIP-seq
MIRT1388379	hsa-miR-4721	CLIP-seq
MIRT2338890	hsa-miR-4725-3p	CLIP-seq
MIRT2116350	hsa-miR-4726-3p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT2116353	hsa-miR-4758-3p	CLIP-seq
MIRT1388387	hsa-miR-4774-3p	CLIP-seq
MIRT2338891	hsa-miR-4776-3p	CLIP-seq
MIRT2116355	hsa-miR-4780	CLIP-seq
MIRT2338892	hsa-miR-4786-3p	CLIP-seq
MIRT2338893	hsa-miR-4794	CLIP-seq
MIRT2116356	hsa-miR-486-3p	CLIP-seq
MIRT2338894	hsa-miR-488	CLIP-seq
MIRT1388392	hsa-miR-510	CLIP-seq
MIRT1388393	hsa-miR-511	CLIP-seq
MIRT2116358	hsa-miR-532-3p	CLIP-seq
MIRT2116359	hsa-miR-544b	CLIP-seq
MIRT1388396	hsa-miR-574-3p	CLIP-seq
MIRT2338895	hsa-miR-575	CLIP-seq
MIRT2338896	hsa-miR-604	CLIP-seq
MIRT2116365	hsa-miR-642b	CLIP-seq
MIRT2116366	hsa-miR-644	CLIP-seq
MIRT2116367	hsa-miR-647	CLIP-seq
MIRT1388401	hsa-miR-708	CLIP-seq
MIRT1388403	hsa-miR-767-3p	CLIP-seq
MIRT1388404	hsa-miR-877	CLIP-seq
MIRT1388307	hsa-miR-101	CLIP-seq
MIRT1388308	hsa-miR-1178	CLIP-seq
MIRT1388314	hsa-miR-144	CLIP-seq
MIRT2338869	hsa-miR-146a	CLIP-seq
MIRT2338870	hsa-miR-146b-5p	CLIP-seq
MIRT1388325	hsa-miR-22	CLIP-seq
MIRT1388328	hsa-miR-31	CLIP-seq
MIRT1388334	hsa-miR-3152-5p	CLIP-seq
MIRT2338877	hsa-miR-3192	CLIP-seq
MIRT1388339	hsa-miR-342-3p	CLIP-seq
MIRT1388343	hsa-miR-3680	CLIP-seq
MIRT1388344	hsa-miR-377	CLIP-seq
MIRT1388354	hsa-miR-4292	CLIP-seq
MIRT1388357	hsa-miR-4308	CLIP-seq
MIRT1388368	hsa-miR-4528	CLIP-seq
MIRT2116342	hsa-miR-4641	CLIP-seq
MIRT1388387	hsa-miR-4774-3p	CLIP-seq
MIRT1388392	hsa-miR-510	CLIP-seq
MIRT1388397	hsa-miR-582-5p	CLIP-seq
MIRT2116365	hsa-miR-642b	CLIP-seq
MIRT1388403	hsa-miR-767-3p	CLIP-seq
MIRT1388317	hsa-miR-150	CLIP-seq
MIRT2116315	hsa-miR-2115	CLIP-seq
MIRT1388346	hsa-miR-3909	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT2116329	hsa-miR-4257	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT2116357	hsa-miR-516a-3p	CLIP-seq
MIRT1388317	hsa-miR-150	CLIP-seq
MIRT2632349	hsa-miR-181a	CLIP-seq
MIRT2632350	hsa-miR-181b	CLIP-seq
MIRT2632351	hsa-miR-181c	CLIP-seq
MIRT2632352	hsa-miR-181d	CLIP-seq
MIRT1388320	hsa-miR-193a-5p	CLIP-seq
MIRT1388324	hsa-miR-2113	CLIP-seq
MIRT2632353	hsa-miR-23a	CLIP-seq
MIRT2632354	hsa-miR-23b	CLIP-seq
MIRT2632355	hsa-miR-23c	CLIP-seq
MIRT1388331	hsa-miR-3120-5p	CLIP-seq
MIRT1388334	hsa-miR-3152-5p	CLIP-seq
MIRT2338878	hsa-miR-3202	CLIP-seq
MIRT1388338	hsa-miR-329	CLIP-seq
MIRT1388339	hsa-miR-342-3p	CLIP-seq
MIRT2632356	hsa-miR-3591-3p	CLIP-seq
MIRT1388341	hsa-miR-362-3p	CLIP-seq
MIRT1388343	hsa-miR-3680	CLIP-seq
MIRT1388344	hsa-miR-377	CLIP-seq
MIRT1388346	hsa-miR-3909	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT1388350	hsa-miR-3937	CLIP-seq
MIRT2632357	hsa-miR-3941	CLIP-seq
MIRT2632358	hsa-miR-4261	CLIP-seq
MIRT2632359	hsa-miR-4262	CLIP-seq
MIRT1388351	hsa-miR-4265	CLIP-seq
MIRT1388355	hsa-miR-4296	CLIP-seq
MIRT1388358	hsa-miR-4322	CLIP-seq
MIRT2338885	hsa-miR-4476	CLIP-seq
MIRT1388368	hsa-miR-4528	CLIP-seq
MIRT1388369	hsa-miR-4533	CLIP-seq
MIRT1388370	hsa-miR-4648	CLIP-seq
MIRT1388371	hsa-miR-4654	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT1388381	hsa-miR-4747-5p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT1388386	hsa-miR-4769-5p	CLIP-seq
MIRT1388387	hsa-miR-4774-3p	CLIP-seq
MIRT1388389	hsa-miR-4789-3p	CLIP-seq
MIRT2632360	hsa-miR-498	CLIP-seq
MIRT1388392	hsa-miR-510	CLIP-seq
MIRT1388393	hsa-miR-511	CLIP-seq
MIRT1388395	hsa-miR-548c-3p	CLIP-seq
MIRT1388396	hsa-miR-574-3p	CLIP-seq
MIRT2632361	hsa-miR-603	CLIP-seq
MIRT2632362	hsa-miR-639	CLIP-seq
MIRT2116365	hsa-miR-642b	CLIP-seq
MIRT1388309	hsa-miR-1254	CLIP-seq
MIRT1388312	hsa-miR-1302	CLIP-seq
MIRT1388317	hsa-miR-150	CLIP-seq
MIRT2632349	hsa-miR-181a	CLIP-seq
MIRT2632350	hsa-miR-181b	CLIP-seq
MIRT2632351	hsa-miR-181c	CLIP-seq
MIRT2632352	hsa-miR-181d	CLIP-seq
MIRT1388320	hsa-miR-193a-5p	CLIP-seq
MIRT1388324	hsa-miR-2113	CLIP-seq
MIRT1388326	hsa-miR-2277-3p	CLIP-seq
MIRT2632353	hsa-miR-23a	CLIP-seq
MIRT2632354	hsa-miR-23b	CLIP-seq
MIRT2632355	hsa-miR-23c	CLIP-seq
MIRT1388329	hsa-miR-3116	CLIP-seq
MIRT1388331	hsa-miR-3120-5p	CLIP-seq
MIRT1388332	hsa-miR-3125	CLIP-seq
MIRT1388334	hsa-miR-3152-5p	CLIP-seq
MIRT1388338	hsa-miR-329	CLIP-seq
MIRT1388339	hsa-miR-342-3p	CLIP-seq
MIRT1388341	hsa-miR-362-3p	CLIP-seq
MIRT1388343	hsa-miR-3680	CLIP-seq
MIRT1388344	hsa-miR-377	CLIP-seq
MIRT1388346	hsa-miR-3909	CLIP-seq
MIRT1388347	hsa-miR-3916	CLIP-seq
MIRT1388348	hsa-miR-3922-5p	CLIP-seq
MIRT1388350	hsa-miR-3937	CLIP-seq
MIRT2632357	hsa-miR-3941	CLIP-seq
MIRT2632359	hsa-miR-4262	CLIP-seq
MIRT1388351	hsa-miR-4265	CLIP-seq
MIRT1388355	hsa-miR-4296	CLIP-seq
MIRT1388356	hsa-miR-4298	CLIP-seq
MIRT1388358	hsa-miR-4322	CLIP-seq
MIRT1388359	hsa-miR-4428	CLIP-seq
MIRT2338885	hsa-miR-4476	CLIP-seq
MIRT1388368	hsa-miR-4528	CLIP-seq
MIRT1388369	hsa-miR-4533	CLIP-seq
MIRT1388370	hsa-miR-4648	CLIP-seq
MIRT1388371	hsa-miR-4654	CLIP-seq
MIRT1388378	hsa-miR-4717-5p	CLIP-seq
MIRT1388381	hsa-miR-4747-5p	CLIP-seq
MIRT1388383	hsa-miR-4753-5p	CLIP-seq
MIRT1388386	hsa-miR-4769-5p	CLIP-seq
MIRT1388387	hsa-miR-4774-3p	CLIP-seq
MIRT1388389	hsa-miR-4789-3p	CLIP-seq
MIRT2632360	hsa-miR-498	CLIP-seq
MIRT1388392	hsa-miR-510	CLIP-seq
MIRT1388393	hsa-miR-511	CLIP-seq
MIRT1388396	hsa-miR-574-3p	CLIP-seq
MIRT2632361	hsa-miR-603	CLIP-seq
MIRT2116365	hsa-miR-642b	CLIP-seq
MIRT1388400	hsa-miR-661	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF6	Unknown	9271374
ELK1	Unknown	15531578
MKL1	Unknown	14565952
NR3C1	Repression	17016446
TEAD1	Unknown	24344135

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	1509260
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000987	Function	Cis-regulatory region sequence-specific DNA binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	19098903, 20808827
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IGI	23764775
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	ISS
GO:0001569	Process	Branching involved in blood vessel morphogenesis	IEA
GO:0001666	Process	Response to hypoxia	IMP	19098903
GO:0001701	Process	In utero embryonic development	IEA
GO:0001701	Process	In utero embryonic development	IEA
GO:0001707	Process	Mesoderm formation	IEA
GO:0001764	Process	Neuron migration	IEA
GO:0001829	Process	Trophectodermal cell differentiation	IDA	17576768
GO:0001947	Process	Heart looping	IEA
GO:0001947	Process	Heart looping	ISS
GO:0002011	Process	Morphogenesis of an epithelial sheet	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IEA
GO:0002042	Process	Cell migration involved in sprouting angiogenesis	IMP	15180964
GO:0002521	Process	Leukocyte differentiation	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	3203386
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IMP	18296735
GO:0005515	Function	Protein binding	IPI	7854423, 8887666, 12397177, 14565952, 17670796, 18497331, 19350017, 25298399
GO:0005634	Component	Nucleus	IDA	2108863
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	15180964
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0007015	Process	Actin filament organization	IEA
GO:0007160	Process	Cell-matrix adhesion	IEA
GO:0007369	Process	Gastrulation	IEA
GO:0007507	Process	Heart development	IEA
GO:0007507	Process	Heart development	ISS
GO:0007616	Process	Long-term memory	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008306	Process	Associative learning	IEA
GO:0009636	Process	Response to toxic substance	TAS	12660819
GO:0009725	Process	Response to hormone	IDA	17975004
GO:0010669	Process	Epithelial structure maintenance	IEA
GO:0010736	Function	Serum response element binding	IBA
GO:0010736	Function	Serum response element binding	IDA	3203386, 23764775
GO:0010736	Function	Serum response element binding	IEA
GO:0021766	Process	Hippocampus development	IEA
GO:0022028	Process	Tangential migration from the subventricular zone to the olfactory bulb	IEA
GO:0030036	Process	Actin cytoskeleton organization	IEA
GO:0030036	Process	Actin cytoskeleton organization	ISS
GO:0030038	Process	Contractile actin filament bundle assembly	IEA
GO:0030155	Process	Regulation of cell adhesion	IEA
GO:0030168	Process	Platelet activation	IEA
GO:0030220	Process	Platelet formation	IEA
GO:0030336	Process	Negative regulation of cell migration	IEA
GO:0030878	Process	Thyroid gland development	IEA
GO:0030900	Process	Forebrain development	IEA
GO:0031175	Process	Neuron projection development	IEA
GO:0031490	Function	Chromatin DNA binding	IEA
GO:0034097	Process	Response to cytokine	IMP	15180964
GO:0034097	Process	Response to cytokine	NAS	3203386
GO:0035855	Process	Megakaryocyte development	IEA
GO:0035912	Process	Dorsal aorta morphogenesis	IEA
GO:0042060	Process	Wound healing	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	3203386
GO:0042826	Function	Histone deacetylase binding	IEA
GO:0043149	Process	Stress fiber assembly	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043589	Process	Skin morphogenesis	IEA
GO:0045059	Process	Positive thymic T cell selection	IEA
GO:0045214	Process	Sarcomere organization	IEA
GO:0045597	Process	Positive regulation of cell differentiation	IDA	17576768
GO:0045773	Process	Positive regulation of axon extension	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	17576768
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	3203386, 8887666, 19098903, 19578358
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	19783823
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0045987	Process	Positive regulation of smooth muscle contraction	IDA	17215356
GO:0046016	Process	Positive regulation of transcription by glucose	IEA
GO:0046716	Process	Muscle cell cellular homeostasis	IEA
GO:0046716	Process	Muscle cell cellular homeostasis	ISS
GO:0046847	Process	Filopodium assembly	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048538	Process	Thymus development	IEA
GO:0048589	Process	Developmental growth	IEA
GO:0048666	Process	Neuron development	TAS	17200232
GO:0048675	Process	Axon extension	IEA
GO:0048821	Process	Erythrocyte development	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	18296735
GO:0051150	Process	Regulation of smooth muscle cell differentiation	TAS	17215356
GO:0051491	Process	Positive regulation of filopodium assembly	IEA
GO:0055003	Process	Cardiac myofibril assembly	IEA
GO:0060055	Process	Angiogenesis involved in wound healing	TAS	15180964
GO:0060218	Process	Hematopoietic stem cell differentiation	IEA
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IDA	8887666
GO:0060292	Process	Long-term synaptic depression	IEA
GO:0060324	Process	Face development	IEA
GO:0060347	Process	Heart trabecula formation	IEA
GO:0060379	Process	Cardiac muscle cell myoblast differentiation	IEA
GO:0060379	Process	Cardiac muscle cell myoblast differentiation	IGI	19783823
GO:0060425	Process	Lung morphogenesis	IEA
GO:0060532	Process	Bronchus cartilage development	IEA
GO:0060534	Process	Trachea cartilage development	IEA
GO:0060947	Process	Cardiac vascular smooth muscle cell differentiation	IEA
GO:0061029	Process	Eyelid development in camera-type eye	IEA
GO:0061145	Process	Lung smooth muscle development	IEA
GO:0061436	Process	Establishment of skin barrier	IEA
GO:0061629	Function	RNA polymerase II-specific DNA-binding transcription factor binding	IEA
GO:0070830	Process	Bicellular tight junction assembly	IEA
GO:0070878	Function	Primary miRNA binding	IEA
GO:0070878	Function	Primary miRNA binding	ISS
GO:0071333	Process	Cellular response to glucose stimulus	IEA
GO:0090009	Process	Primitive streak formation	IEA
GO:0090136	Process	Epithelial cell-cell adhesion	IEA
GO:0090398	Process	Cellular senescence	IMP	15282327
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0140297	Function	DNA-binding transcription factor binding	IPI	16054032, 18296735
GO:1900222	Process	Negative regulation of amyloid-beta clearance	IMP	19098903
GO:1902894	Process	Negative regulation of miRNA transcription	IEA
GO:1902894	Process	Negative regulation of miRNA transcription	ISS
GO:1902895	Process	Positive regulation of miRNA transcription	IEA
GO:1902895	Process	Positive regulation of miRNA transcription	IGI	23764775
GO:1902895	Process	Positive regulation of miRNA transcription	ISS
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

Other IDs

• MIM: 600589
• HGNC: 11291
• e!Ensembl: ENSG00000112658

Protein

• UniProt ID: P11831
• Protein name: Serum response factor (SRF)
• Protein function: SRF is a transcription factor that binds to the serum response element (SRE), a short sequence of dyad symmetry located 300 bp to the 5' of the site of transcription initiation of some genes (such as FOS). Together with MRTFA transcription coact
• PDB: 1HBX, 1K6O, 1SRS
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00319	SRF-TF	150 → 197	SRF-type transcription factor (DNA-binding and dimerisation domain)	Domain

• Sequence:

  MLPTQAGAAAALGRGSALGGSLNRTPTGRPGGGGGTRGANGGRVPGNGAGLGPGRLEREA
  AAAAATTPAPTAGALYSGSEGDSESGEEEELGAERRGLKRSLSEMEIGMVVGGPEASAAA
  TGGYGPVSGAVSGAKPGKKTRGRVKIKMEFIDNKLRRYTTFSKRKTGIMKKAYELSTLTG
  TQVLLLVASETGHVYTFATRKLQPMITSETGKALIQTCLNSPDSPPRSDPTTDQRMSATG
  FEETDLTYQVSESDSSGETKDTLKPAFTVTNLPGTTSTIQTAPSTSTTMQVSSGPSFPIT
  NYLAPVSASVSPSAVSSANGTVLKSTGSGPVSSGGLMQLPTSFTLMPGGAVAQQVPVQAI
  QVHQAPQQASPSRDSSTDLTQTSSSGTVTLPATIMTSSVPTTVGGHMMYPSPHAVMYAPT
  SGLGDGSLTVLNAFSQAPSTMQVSHSQVQEPGGVPQVFLTASSGTVQIPVSAVQLHQMAV
  IGQQAGSSSNLTELQVVNLDTAHSTKSE

• Sequence length: 508

Pathways

KEGG:

MAPK signaling pathway
cGMP-PKG signaling pathway
Human T-cell leukemia virus 1 infection
Viral carcinogenesis

Reactome:

RHO GTPases Activate Formins
NGF-stimulated transcription
Estrogen-dependent nuclear events downstream of ESR-membrane signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CARDIOMYOPATHIES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEART DISEASE	—	ClinGen, Disgenet, GWAS catalog ClinGen, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TETRALOGY OF FALLOT	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	16847333, 17699722, 19136660, 21856814, 25999144, 26224645, 26554816, 28005397, 28546428, 28623279, 28638990, 29335431, 29400712, 30244496, 31582539		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	15313381		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	24627437, 31323040		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	28165114		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	19513551		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34185408	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	25523945	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	31375980		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	17116645		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	23308381		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19198601, 26885614, 27435395, 27587661		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17934210, 21670154, 26179713, 26885614, 31894257	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	23576568	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36421692	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23134219		★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	34067464	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30371874		★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	29400712		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	11247792		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	25338953	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	16260633, 30762586		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	21769134, 22563064, 24088304, 30762586, 30971740		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34185408	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	24510125, 28473286		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30365040		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30365040		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28176371		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	29066347		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21998125, 28260872		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15313381		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	11893590, 12874181, 12920479, 16260633, 22563064		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	31815603		★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	31815603	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28607167		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	19307725		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33083497	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	34417138	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	10493724, 28716058, 30621209		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	28716058		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31435710, 31442911		★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	19513551		★☆☆☆☆ Found in Text Mining only
Friedreich Ataxia	Friedreich Ataxia	BEFREE	20808827		★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	15180964		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	21192842		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	21192842	Associate	★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	BEFREE	30565344		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	11893590, 12874181, 12920479, 16260633, 22563064		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	21410985	Inhibit	★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	34185408	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28176371, 29169155		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	25402621		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24510125		★☆☆☆☆ Found in Text Mining only
LATERAL MENINGOCELE SYNDROME	Lateral Meningocele Syndrome	BEFREE	21192842		★☆☆☆☆ Found in Text Mining only
Left Bundle-Branch Block	Left Bundle-Branch Block	BEFREE	28772031		★☆☆☆☆ Found in Text Mining only
leiomyosarcoma	Leiomyosarcoma	BEFREE	21192842		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	21192842, 25028927	Associate	★☆☆☆☆ Found in Text Mining only
LIMB-MAMMARY SYNDROME	Limb-Mammary Syndrome	BEFREE	21192842		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19726678, 20144681, 20811705, 21842128, 24173109, 25266280, 28114277, 31186405, 31844251		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	12654640, 15514113		★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	LHGDN	12654640		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26885614, 27435395, 27587661		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30371874		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	26498848, 27695057		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	11980664, 17975004, 21622724, 22456196, 23359479, 23469924, 23576568, 26005860, 26250344, 28249598, 29608018, 30742064		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25080937, 29181687, 30500416		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15313381, 17699722, 24495796, 27435395, 28035058, 29317486, 29608018, 30371874		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	17116645		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30365040		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15313381		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28607167		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31375980		★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, X-LINKED, SNYDER-ROBINSON TYPE	Mental retardation	BEFREE	28716058		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	23692340		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	BEFREE	25402621		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	25402621		★☆☆☆☆ Found in Text Mining only
Myelomonocytic leukemia	Myelomonocytic Leukemia	BEFREE	19584403		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	21893058	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	28152551		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16819512, 19513551, 19726678, 23134219, 28114277, 28251884, 29181687, 29934435, 30371874, 30744448, 31478943		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	17116645		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	30771308		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29196028		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23152437		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	26498848, 27695057		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27695057	Associate	★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19513551		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35397550	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	26283014		★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	19079548		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	11980664, 17975004, 21622724, 22456196, 23359479, 23469924, 23576568, 26005860, 26250344, 28249598, 29608018, 30742064		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	17975004		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21622724, 23576568, 26250344, 28249598, 37377210, 37385752, 37582751	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	23359479		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	19307725		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21998125	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28886261		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	27927603		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	32187044	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10050673		★☆☆☆☆ Found in Text Mining only
Russell-Silver syndrome	Russell-Silver Syndrome	BEFREE	28716058		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	31375980		★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	30951312		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	19307725		★☆☆☆☆ Found in Text Mining only
SMITH-MCCORT DYSPLASIA 1	Smith-McCort Dysplasia	BEFREE	28152551, 29931229, 31815603		★☆☆☆☆ Found in Text Mining only
Soft Tissue Neoplasms	Soft Tissue Neoplasms	BEFREE	28248815		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	30463073		★☆☆☆☆ Found in Text Mining only
Stage IV Skin Melanoma	Skin Melanoma	BEFREE	29338133		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	10493724, 28716058		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	23134219, 25080937, 30500416		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	21060154		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	25009298, 25080937, 28251884, 28900514	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	24706986, 28285914, 30951312		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	30337297	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	19513551		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	30272326	Associate	★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	19513551		★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	28248815, 31478943		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	19720868		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	28258189	Associate	★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform Macular Dystrophy	BEFREE	31509457		★☆☆☆☆ Found in Text Mining only