Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	666
Gene name	BCL2 family apoptosis regulator BOK
Gene symbol	BOK
Synonyms (NCBI Gene)	BCL2L9BOKL
Chromosome	2
Chromosome location	2q37.3
Summary	The protein encoded by this gene belongs to the BCL2 family, members of which form homo- or heterodimers, and act as anti- or proapoptotic regulators that are involved in a wide variety of cellular processes. Studies in rat show that this protein has rest

112

Show/Hide all (112)

miRTarBase ID	miRNA	Experiments	Reference
MIRT043544	hsa-miR-331-3p	CLASH	23622248
MIRT823668	hsa-miR-1200	CLIP-seq
MIRT823669	hsa-miR-1248	CLIP-seq
MIRT823670	hsa-miR-125a-3p	CLIP-seq
MIRT823671	hsa-miR-1273f	CLIP-seq
MIRT823672	hsa-miR-1285	CLIP-seq
MIRT823673	hsa-miR-1291	CLIP-seq
MIRT823674	hsa-miR-1343	CLIP-seq
MIRT823675	hsa-miR-143	CLIP-seq
MIRT823676	hsa-miR-147	CLIP-seq
MIRT823677	hsa-miR-296-5p	CLIP-seq
MIRT823678	hsa-miR-3135	CLIP-seq
MIRT823679	hsa-miR-3151	CLIP-seq
MIRT823680	hsa-miR-3186-5p	CLIP-seq
MIRT823681	hsa-miR-3187-5p	CLIP-seq
MIRT823682	hsa-miR-328	CLIP-seq
MIRT823683	hsa-miR-3649	CLIP-seq
MIRT823684	hsa-miR-3665	CLIP-seq
MIRT823685	hsa-miR-378g	CLIP-seq
MIRT823686	hsa-miR-3911	CLIP-seq
MIRT823687	hsa-miR-3934	CLIP-seq
MIRT823688	hsa-miR-3942-3p	CLIP-seq
MIRT823689	hsa-miR-4314	CLIP-seq
MIRT823690	hsa-miR-4324	CLIP-seq
MIRT823691	hsa-miR-4447	CLIP-seq
MIRT823692	hsa-miR-4472	CLIP-seq
MIRT823693	hsa-miR-4486	CLIP-seq
MIRT823694	hsa-miR-4488	CLIP-seq
MIRT823695	hsa-miR-4697-5p	CLIP-seq
MIRT823696	hsa-miR-4708-5p	CLIP-seq
MIRT823697	hsa-miR-4747-5p	CLIP-seq
MIRT823698	hsa-miR-4770	CLIP-seq
MIRT823699	hsa-miR-4778-3p	CLIP-seq
MIRT823700	hsa-miR-491-5p	CLIP-seq
MIRT823701	hsa-miR-544b	CLIP-seq
MIRT823702	hsa-miR-612	CLIP-seq
MIRT823703	hsa-miR-644	CLIP-seq
MIRT823704	hsa-miR-764	CLIP-seq
MIRT1943515	hsa-miR-1203	CLIP-seq
MIRT823670	hsa-miR-125a-3p	CLIP-seq
MIRT1943516	hsa-miR-1293	CLIP-seq
MIRT1943517	hsa-miR-193a-5p	CLIP-seq
MIRT1943518	hsa-miR-2355-5p	CLIP-seq
MIRT1943519	hsa-miR-24	CLIP-seq
MIRT1943520	hsa-miR-2861	CLIP-seq
MIRT1943521	hsa-miR-3119	CLIP-seq
MIRT1943522	hsa-miR-3127-3p	CLIP-seq
MIRT823687	hsa-miR-3934	CLIP-seq
MIRT1943523	hsa-miR-4286	CLIP-seq
MIRT1943524	hsa-miR-4437	CLIP-seq
MIRT1943525	hsa-miR-4483	CLIP-seq
MIRT1943526	hsa-miR-4492	CLIP-seq
MIRT1943527	hsa-miR-4497	CLIP-seq
MIRT1943528	hsa-miR-4498	CLIP-seq
MIRT1943529	hsa-miR-4508	CLIP-seq
MIRT1943530	hsa-miR-4512	CLIP-seq
MIRT1943531	hsa-miR-4527	CLIP-seq
MIRT1943532	hsa-miR-4650-5p	CLIP-seq
MIRT1943533	hsa-miR-4717-5p	CLIP-seq
MIRT1943534	hsa-miR-4721	CLIP-seq
MIRT1943535	hsa-miR-4728-5p	CLIP-seq
MIRT1943536	hsa-miR-4743	CLIP-seq
MIRT1943537	hsa-miR-4755-3p	CLIP-seq
MIRT1943538	hsa-miR-604	CLIP-seq
MIRT1943539	hsa-miR-647	CLIP-seq
MIRT1943540	hsa-miR-661	CLIP-seq
MIRT1943541	hsa-miR-718	CLIP-seq
MIRT1943542	hsa-miR-762	CLIP-seq
MIRT823704	hsa-miR-764	CLIP-seq
MIRT823670	hsa-miR-125a-3p	CLIP-seq
MIRT2182184	hsa-miR-2278	CLIP-seq
MIRT1943519	hsa-miR-24	CLIP-seq
MIRT2182185	hsa-miR-3150a-3p	CLIP-seq
MIRT2182186	hsa-miR-3155	CLIP-seq
MIRT2182187	hsa-miR-3155b	CLIP-seq
MIRT2182188	hsa-miR-3175	CLIP-seq
MIRT2182189	hsa-miR-3622a-3p	CLIP-seq
MIRT2182190	hsa-miR-3622b-3p	CLIP-seq
MIRT823685	hsa-miR-378g	CLIP-seq
MIRT823687	hsa-miR-3934	CLIP-seq
MIRT2182191	hsa-miR-412	CLIP-seq
MIRT2182192	hsa-miR-4283	CLIP-seq
MIRT1943524	hsa-miR-4437	CLIP-seq
MIRT2182193	hsa-miR-4489	CLIP-seq
MIRT2182194	hsa-miR-4645-5p	CLIP-seq
MIRT2182195	hsa-miR-4673	CLIP-seq
MIRT1943537	hsa-miR-4755-3p	CLIP-seq
MIRT2182196	hsa-miR-484	CLIP-seq
MIRT823700	hsa-miR-491-5p	CLIP-seq
MIRT2182197	hsa-miR-576-3p	CLIP-seq
MIRT1943538	hsa-miR-604	CLIP-seq
MIRT823704	hsa-miR-764	CLIP-seq
MIRT2182198	hsa-miR-765	CLIP-seq
MIRT2182199	hsa-miR-939	CLIP-seq
MIRT823676	hsa-miR-147	CLIP-seq
MIRT2182185	hsa-miR-3150a-3p	CLIP-seq
MIRT823679	hsa-miR-3151	CLIP-seq
MIRT2182188	hsa-miR-3175	CLIP-seq
MIRT823680	hsa-miR-3186-5p	CLIP-seq
MIRT2182189	hsa-miR-3622a-3p	CLIP-seq
MIRT2182190	hsa-miR-3622b-3p	CLIP-seq
MIRT823686	hsa-miR-3911	CLIP-seq
MIRT823691	hsa-miR-4447	CLIP-seq
MIRT823692	hsa-miR-4472	CLIP-seq
MIRT823694	hsa-miR-4488	CLIP-seq
MIRT2384848	hsa-miR-4667-5p	CLIP-seq
MIRT823695	hsa-miR-4697-5p	CLIP-seq
MIRT2384849	hsa-miR-4700-5p	CLIP-seq
MIRT2384850	hsa-miR-4793-3p	CLIP-seq
MIRT823700	hsa-miR-491-5p	CLIP-seq
MIRT823703	hsa-miR-644	CLIP-seq
MIRT2182199	hsa-miR-939	CLIP-seq

Show/Hide all (77)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001836	Process	Release of cytochrome c from mitochondria	IBA
GO:0001836	Process	Release of cytochrome c from mitochondria	IDA	27505430
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	15868100, 23884412, 32814053
GO:0005634	Component	Nucleus	IDA	16302269, 19095301, 19942931, 20673843
GO:0005634	Component	Nucleus	IEA
GO:0005640	Component	Nuclear outer membrane	IEA
GO:0005737	Component	Cytoplasm	IDA	15868100, 16302269, 19942931, 20673843
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IDA	15102863, 19095301, 19942931
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IDA	24113155
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005768	Component	Endosome	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	16302269
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	27505430
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IDA	27505430
GO:0005794	Component	Golgi apparatus	IEA
GO:0006915	Process	Apoptotic process	IDA	15102863
GO:0006915	Process	Apoptotic process	IEA
GO:0006921	Process	Cellular component disassembly involved in execution phase of apoptosis	IEA
GO:0006921	Process	Cellular component disassembly involved in execution phase of apoptosis	ISS
GO:0008584	Process	Male gonad development	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA
GO:0010506	Process	Regulation of autophagy	IMP	24113155
GO:0015267	Function	Channel activity	IBA
GO:0016020	Component	Membrane	IDA	19942931
GO:0016020	Component	Membrane	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031901	Component	Early endosome membrane	IEA
GO:0031901	Component	Early endosome membrane	ISS
GO:0031966	Component	Mitochondrial membrane	IDA	15868100, 27505430
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032588	Component	Trans-Golgi network membrane	IEA
GO:0032588	Component	Trans-Golgi network membrane	ISS
GO:0033106	Component	Cis-Golgi network membrane	IEA
GO:0033106	Component	Cis-Golgi network membrane	ISS
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	ISS
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IDA	16302269, 27505430
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0046982	Function	Protein heterodimerization activity	ISS
GO:0046983	Function	Protein dimerization activity	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0051259	Process	Protein complex oligomerization	IEA
GO:0051259	Process	Protein complex oligomerization	ISS
GO:0051400	Function	BH domain binding	IEA
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051480	Process	Regulation of cytosolic calcium ion concentration	IEA
GO:0051902	Process	Negative regulation of mitochondrial depolarization	IEA
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0055038	Component	Recycling endosome membrane	ISS
GO:0055085	Process	Transmembrane transport	IEA
GO:0060546	Process	Negative regulation of necroptotic process	IEA
GO:0072332	Process	Intrinsic apoptotic signaling pathway by p53 class mediator	IMP	15102863
GO:0072718	Process	Response to cisplatin	IEA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IBA
GO:1900119	Process	Positive regulation of execution phase of apoptosis	IMP	20673843
GO:1901029	Process	Negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IEA
GO:1901030	Process	Positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IEA
GO:1901030	Process	Positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	ISS
GO:1901382	Process	Regulation of chorionic trophoblast cell proliferation	IDA	19942931
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	IEA
GO:1902237	Process	Positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway	ISS
GO:1903899	Process	Positive regulation of PERK-mediated unfolded protein response	IEA
GO:1903899	Process	Positive regulation of PERK-mediated unfolded protein response	ISS
GO:1904708	Process	Regulation of granulosa cell apoptotic process	IMP	20673843
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	IEA
GO:2001244	Process	Positive regulation of intrinsic apoptotic signaling pathway	ISS

MIM	HGNC	e!Ensembl
605404	1087	ENSG00000176720

Q9UMX3

Protein name

Bcl-2-related ovarian killer protein (hBOK) (Bcl-2-like protein 9) (Bcl2-L-9)

Protein function

[Isoform 1]: Apoptosis regulator that functions through different apoptotic signaling pathways (PubMed:15102863, PubMed:20673843, PubMed:27076518). Plays a roles as pro-apoptotic protein that positively regulates intrinsic apoptotic process in a

PDB

6CKV

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00452	Bcl-2	70 → 171	Apoptosis regulator proteins, Bcl-2 family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed mainly in oocytes; weak expression in granulosa cells of the developing follicles. In adult human ovaries, expressed in granulosa cells at all follicular stages, but expression in primordial/primary follicles granulosa cell i

Sequence

MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREYVHARLLRAGLSWSAPERAAPVP
GRLAEVCAVLLRLGDELEMIRPSVYRNVARQLHISLQSEPVVTDAFLAVAGHIFSAGITW
GKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKTLATWLRRRGGWTDVLKCVVS
TDPGLRSHWLVAALCSFGRFLKAAFFVLLPER

Sequence length

212

Interactions

View interactions

	KEGG
	Apoptosis - multiple species

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (19)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28744854		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	27556459		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29156771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15868100	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29374142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29374142	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Avellino type	Corneal dystrophy	Pubtator	19497990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15868100	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	21184732		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29156771		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31563901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29635130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28744854, 29374142		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28744854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	34001648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31563901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22829758	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29635130		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	19405089		★★★★★ ★☆☆☆☆ Found in Text Mining only

BOK (BCL2 family apoptosis regulator BOK)