Gene Gene information from NCBI Gene database.
Entrez ID 6654
Gene name SOS Ras/Rac guanine nucleotide exchange factor 1
Gene symbol SOS1
Synonyms (NCBI Gene)
GF1GGF1GINGFHGFNS4SOS-1
Chromosome 2
Chromosome location 2p22.1
Summary This gene encodes a protein that is a guanine nucleotide exchange factor for RAS proteins, membrane proteins that bind guanine nucleotides and participate in signal transduction pathways. GTP binding activates and GTP hydrolysis inactivates RAS proteins.
SNPs SNP information provided by dbSNP.
57
SNP ID Visualize variation Clinical significance Consequence
rs137852812 G>T Pathogenic Coding sequence variant, missense variant
rs137852813 A>C,G Pathogenic Coding sequence variant, missense variant
rs137852814 T>A,C Likely-pathogenic, pathogenic-likely-pathogenic, pathogenic Coding sequence variant, missense variant
rs138459502 G>A,C Uncertain-significance, likely-benign, likely-pathogenic Coding sequence variant, synonymous variant, missense variant
rs139290271 A>G Benign, conflicting-interpretations-of-pathogenicity Coding sequence variant, missense variant
miRNA miRNA information provided by mirtarbase database.
522
miRTarBase ID miRNA Experiments Reference
MIRT046240 hsa-miR-23b-3p CLASH 23622248
MIRT437439 hsa-miR-124-3p Luciferase reporter assayqRT-PCRWestern blot 23817964
MIRT437439 hsa-miR-124-3p Luciferase reporter assayqRT-PCRWestern blot 23817964
MIRT437439 hsa-miR-124-3p Luciferase reporter assayqRT-PCRWestern blot 23817964
MIRT437439 hsa-miR-124-3p Luciferase reporter assayqRT-PCRWestern blot 23817964
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
65
GO ID Ontology Definition Evidence Reference
GO:0001782 Process B cell homeostasis IEA
GO:0001942 Process Hair follicle development IEA
GO:0002260 Process Lymphocyte homeostasis IEA
GO:0002931 Process Response to ischemia IEA
GO:0003007 Process Heart morphogenesis IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
182530 11187 ENSG00000115904
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q07889
Protein name Son of sevenless homolog 1 (SOS-1)
Protein function Promotes the exchange of Ras-bound GDP by GTP (PubMed:8493579). Probably by promoting Ras activation, regulates phosphorylation of MAP kinase MAPK3/ERK1 in response to EGF (PubMed:17339331). Catalytic component of a trimeric complex that partici
PDB 1AWE , 1BKD , 1DBH , 1NVU , 1NVV , 1NVW , 1NVX , 1Q9C , 1XD2 , 1XD4 , 1XDV , 2II0 , 3KSY , 4NYI , 4NYJ , 4NYM , 4URU , 4URV , 4URW , 4URX , 4URY , 4URZ , 4US0 , 4US1 , 4US2 , 5OVD , 5OVE , 5OVF , 5OVG , 5OVH , 5OVI , 5WFO , 5WFP , 5WFQ , 5WFR , 6BVI , 6BVJ , 6BVK , 6BVL , 6BVM , 6CUO , 6CUP , 6CUR , 6D55 , 6D56 , 6D59 , 6D5E , 6D5G , 6D5H , 6D5J , 6D5L
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00125 Histone 40 169 Core histone H2A/H2B/H3/H4 Domain
PF00621 RhoGEF 211 388 RhoGEF domain Domain
PF00169 PH 428 546 PH domain Domain
PF00618 RasGEF_N 600 717 RasGEF N-terminal motif Domain
PF00617 RasGEF 783 962 RasGEF domain Family
Tissue specificity TISSUE SPECIFICITY: Expressed in gingival tissues. {ECO:0000269|PubMed:11868160}.
Sequence
MQAQQLPYEFFSEENAPKWRGLLVPALKKVQGQVHPTLESNDDALQYVEELILQLLNMLC
QAQPRSASDVEERVQKSFPHPIDKWAIADAQSAIEKRKRRNPLSLPVEKIHPLLKEVLGY
KIDHQVSVYIVAVLEYISADILKLVGNYVRNIRHYEITKQDIKVAMCAD
KVLMDMFHQDV
EDINILSLTDEEPSTSGEQTYYDLVKAFMAEIRQYIRELNLIIKVFREPFVSNSKLFSAN
DVENIFSRIVDIHELSVKLLGHIEDTVEMTDEGSPHPLVGSCFEDLAEELAFDPYESYAR
DILRPGFHDRFLSQLSKPGAALYLQSIGEGFKEAVQYVLPRLLLAPVYHCLHYFELLKQL
EEKSEDQEDKECLKQAITALLNVQSGME
KICSKSLAKRRLSESACRFYSQQMKGKQLAIK
KMNEIQKNIDGWEGKDIGQCCNEFIMEGTLTRVGAKHERHIFLFDGLMICCKSNHGQPRL
PGASNAEYRLKEKFFMRKVQINDKDDTNEYKHAFEIILKDENSVIFSAKSAEEKNNWMAA
LISLQY
RSTLERMLDVTMLQEEKEEQMRLPSADVYRFAEPDSEENIIFEENMQPKAGIPI
IKAGTVIKLIERLTYHMYADPNFVRTFLTTYRSFCKPQELLSLIIERFEIPEPEPTEADR
IAIENGDQPLSAELKRFRKEYIQPVQLRVLNVCRHWVEHHFYDFERDAYLLQRMEEF
IGT
VRGKAMKKWVESITKIIQRKKIARDNGPGHNITFQSSPPTVEWHISRPGHIETFDLLTLH
PIEIARQLTLLESDLYRAVQPSELVGSVWTKEDKEINSPNLLKMIRHTTNLTLWFEKCIV
ETENLEERVAVVSRIIEILQVFQELNNFNGVLEVVSAMNSSPVYRLDHTFEQIPSRQKKI
LEEAHELSEDHYKKYLAKLRSINPPCVPFFGIYLTNILKTEEGNPEVLKRHGKELINFSK
RR
KVAEITGEIQQYQNQPYCLRVESDIKRFFENLNPMGNSMEKEFTDYLFNKSLEIEPRN
PKPLPRFPKKYSYPLKSPGVRPSNPRPGTMRHPTPLQQEPRKISYSRIPESETESTASAP
NSPRTPLTPPPASGASSTTDVCSVFDSDHSSPFHSSNDTVFIQVTLPHGPRSASVSSISL
TKGTDEVPVPPPVPPRRRPESAPAESSPSKIMSKHLDSPPAIPPRQPTSKAYSPRYSISD
RTSISDPPESPPLLPPREPVRTPDVFSSSPLHLQPPPLGKKSDHGNAFFPNSPSPFTPPP
PQTPSPHGTRRHLPSPPLTQEVDLHSIAGPPVPPRQSTSQHIPKLPPKTYKREHTHPSMH
RDGPPLLENAHSS
Sequence length 1333
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  EGFR tyrosine kinase inhibitor resistance
Endocrine resistance
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Chemokine signaling pathway
FoxO signaling pathway
Phospholipase D signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Focal adhesion
Gap junction
JAK-STAT signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Thermogenesis
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Estrogen signaling pathway
Prolactin signaling pathway
Relaxin signaling pathway
Growth hormone synthesis, secretion and action
Alcoholism
Hepatitis C
Hepatitis B
Human cytomegalovirus infection
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Chemical carcinogenesis - receptor activation
Chemical carcinogenesis - reactive oxygen species
Colorectal cancer
Renal cell carcinoma
Endometrial cancer
Glioma
Prostate cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Choline metabolism in cancer
  SOS-mediated signalling
Constitutive Signaling by Ligand-Responsive EGFR Cancer Variants
SHC1 events in ERBB4 signaling
Signaling by SCF-KIT
Regulation of KIT signaling
Signalling to RAS
GRB2 events in EGFR signaling
SHC1 events in EGFR signaling
Downstream signal transduction
NRAGE signals death through JNK
Rho GTPase cycle
GRB2 events in ERBB2 signaling
Tie2 Signaling
EGFR Transactivation by Gastrin
DAP12 signaling
SHC-related events triggered by IGF1R
Role of LAT2/NTAL/LAB on calcium mobilization
FCERI mediated MAPK activation
FCERI mediated Ca+2 mobilization
GRB2:SOS provides linkage to MAPK signaling for Integrins
NCAM signaling for neurite out-growth
G alpha (12/13) signalling events
Constitutive Signaling by EGFRvIII
SHC-mediated cascade:FGFR1
FRS-mediated FGFR1 signaling
SHC-mediated cascade:FGFR2
FRS-mediated FGFR2 signaling
SHC-mediated cascade:FGFR3
FRS-mediated FGFR3 signaling
FRS-mediated FGFR4 signaling
SHC-mediated cascade:FGFR4
Signaling by FGFR2 in disease
Signaling by FGFR4 in disease
Signaling by FGFR1 in disease
RAF/MAP kinase cascade
Signal attenuation
Insulin receptor signalling cascade
MET activates RAS signaling
Signaling by FGFR3 fusions in cancer
Signaling by FGFR3 point mutants in cancer
RET signaling
Interleukin-15 signaling
Activated NTRK2 signals through FRS2 and FRS3
Interleukin receptor SHC signaling
FLT3 Signaling
Constitutive Signaling by Overexpressed ERBB2
Signaling by ERBB2 KD Mutants
Signaling by ERBB2 ECD mutants
Signaling by ERBB2 TMD/JMD mutants
Signaling by PDGFRA transmembrane, juxtamembrane and kinase domain mutants
Signaling by PDGFRA extracellular domain mutants
Antigen activates B Cell Receptor (BCR) leading to generation of second messengers
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
61
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
46,XY partial gonadal dysgenesis Likely pathogenic rs1671229414 RCV002254534
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Abnormal aortic valve morphology Pathogenic rs397517154 RCV000626887
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Abnormal sternum morphology Likely pathogenic; Pathogenic rs397517148 RCV000626886
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Cardiovascular phenotype Likely pathogenic; Pathogenic rs397517150, rs137852813, rs137852814, rs397517172, rs397517148, rs397517149, rs397517153, rs397517154, rs267607079, rs397517159, rs397517146 RCV002384544
RCV002415412
RCV002399321
RCV002345263
RCV002415451
View all (9 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Arrhythmogenic right ventricular cardiomyopathy Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Atrial septal defect Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATRIAL SEPTAL DEFECTS Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
AA amyloidosis AA amyloidosis BEFREE 27796618
★☆☆☆☆
Found in Text Mining only
Aarskog syndrome Aarskog Syndrome BEFREE 10906777, 11181572, 29051140
★☆☆☆☆
Found in Text Mining only
Abnormal dermatoglyphic pattern Abnormal dermatoglyphic pattern HPO_DG
★☆☆☆☆
Found in Text Mining only
Acoustic Neuroma Acoustic Neuroma BEFREE 25692621, 29440379
★☆☆☆☆
Found in Text Mining only
Acquired cubitus valgus Cubitus valgus HPO_DG
★☆☆☆☆
Found in Text Mining only
Acute Coronary Syndrome Coronary Syndrome LHGDN 15226629
★☆☆☆☆
Found in Text Mining only
Acute lymphocytic leukemia Lymphocytic Leukemia BEFREE 26855057
★☆☆☆☆
Found in Text Mining only
Acute monocytic leukemia Monocytic Leukemia BEFREE 30635434
★☆☆☆☆
Found in Text Mining only
Acute Myeloid Leukemia (AML-M2) Leukemia CTD_human_DG 22683780
★☆☆☆☆
Found in Text Mining only
Acute Myeloid Leukemia, M1 Myeloid Leukemia CTD_human_DG 22683780
★☆☆☆☆
Found in Text Mining only