SORL1 (sortilin related receptor 1)

Gene

• Entrez ID: 6653
• Gene name: Sortilin related receptor 1
• Gene symbol: SORL1
• Synonyms (NCBI Gene): C11orf32, LR11, LRP9, SORLA, SorLA-1, gp250
• Chromosome: 11
• Chromosome location: 11q24.1
• Summary: This gene encodes a mosaic protein that belongs to at least two families: the vacuolar protein sorting 10 (VPS10) domain-containing receptor family, and the low density lipoprotein receptor (LDLR) family. The encoded protein also contains fibronectin type

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT439562	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT439562	hsa-miR-127-5p	HITS-CLIP	24374217
MIRT1379664	hsa-miR-100	CLIP-seq
MIRT1379665	hsa-miR-101	CLIP-seq
MIRT1379666	hsa-miR-1179	CLIP-seq
MIRT1379667	hsa-miR-1185	CLIP-seq
MIRT1379668	hsa-miR-1224-5p	CLIP-seq
MIRT1379669	hsa-miR-1262	CLIP-seq
MIRT1379670	hsa-miR-1273f	CLIP-seq
MIRT1379671	hsa-miR-1293	CLIP-seq
MIRT1379672	hsa-miR-1304	CLIP-seq
MIRT1379673	hsa-miR-144	CLIP-seq
MIRT1379674	hsa-miR-183	CLIP-seq
MIRT1379675	hsa-miR-199a-3p	CLIP-seq
MIRT1379676	hsa-miR-199b-3p	CLIP-seq
MIRT1379677	hsa-miR-19a	CLIP-seq
MIRT1379678	hsa-miR-19b	CLIP-seq
MIRT1379679	hsa-miR-205	CLIP-seq
MIRT1379680	hsa-miR-3126-5p	CLIP-seq
MIRT1379681	hsa-miR-3129-5p	CLIP-seq
MIRT1379682	hsa-miR-3185	CLIP-seq
MIRT1379683	hsa-miR-3200-5p	CLIP-seq
MIRT1379684	hsa-miR-338-3p	CLIP-seq
MIRT1379685	hsa-miR-3605-5p	CLIP-seq
MIRT1379686	hsa-miR-3614-5p	CLIP-seq
MIRT1379687	hsa-miR-3622b-5p	CLIP-seq
MIRT1379688	hsa-miR-3671	CLIP-seq
MIRT1379689	hsa-miR-3679-5p	CLIP-seq
MIRT1379690	hsa-miR-3714	CLIP-seq
MIRT1379691	hsa-miR-371-5p	CLIP-seq
MIRT1379692	hsa-miR-371b-5p	CLIP-seq
MIRT1379693	hsa-miR-382	CLIP-seq
MIRT1379694	hsa-miR-3915	CLIP-seq
MIRT1379695	hsa-miR-3936	CLIP-seq
MIRT1379696	hsa-miR-4251	CLIP-seq
MIRT1379697	hsa-miR-4253	CLIP-seq
MIRT1379698	hsa-miR-4283	CLIP-seq
MIRT1379699	hsa-miR-4310	CLIP-seq
MIRT1379700	hsa-miR-4329	CLIP-seq
MIRT1379701	hsa-miR-4419a	CLIP-seq
MIRT1379702	hsa-miR-4437	CLIP-seq
MIRT1379703	hsa-miR-4447	CLIP-seq
MIRT1379704	hsa-miR-4470	CLIP-seq
MIRT1379705	hsa-miR-4472	CLIP-seq
MIRT1379706	hsa-miR-4483	CLIP-seq
MIRT1379707	hsa-miR-4488	CLIP-seq
MIRT1379708	hsa-miR-4493	CLIP-seq
MIRT1379709	hsa-miR-4509	CLIP-seq
MIRT1379710	hsa-miR-4510	CLIP-seq
MIRT1379711	hsa-miR-4530	CLIP-seq
MIRT1379712	hsa-miR-4643	CLIP-seq
MIRT1379713	hsa-miR-4689	CLIP-seq
MIRT1379714	hsa-miR-4697-5p	CLIP-seq
MIRT1379715	hsa-miR-4701-3p	CLIP-seq
MIRT1379716	hsa-miR-4710	CLIP-seq
MIRT1379717	hsa-miR-4753-3p	CLIP-seq
MIRT1379718	hsa-miR-4760-5p	CLIP-seq
MIRT1379719	hsa-miR-4775	CLIP-seq
MIRT1379720	hsa-miR-508-5p	CLIP-seq
MIRT1379721	hsa-miR-548m	CLIP-seq
MIRT1379722	hsa-miR-555	CLIP-seq
MIRT1379723	hsa-miR-561	CLIP-seq
MIRT1379724	hsa-miR-590-3p	CLIP-seq
MIRT1379725	hsa-miR-593	CLIP-seq
MIRT1379726	hsa-miR-7	CLIP-seq
MIRT1379727	hsa-miR-766	CLIP-seq
MIRT1379728	hsa-miR-936	CLIP-seq
MIRT1379729	hsa-miR-99a	CLIP-seq
MIRT1379730	hsa-miR-99b	CLIP-seq
MIRT1553938	hsa-miR-1324	CLIP-seq
MIRT1553939	hsa-miR-3942-3p	CLIP-seq
MIRT1553940	hsa-miR-4320	CLIP-seq
MIRT1379665	hsa-miR-101	CLIP-seq
MIRT2113425	hsa-miR-1184	CLIP-seq
MIRT2113426	hsa-miR-1224-3p	CLIP-seq
MIRT2113427	hsa-miR-1236	CLIP-seq
MIRT2113428	hsa-miR-1256	CLIP-seq
MIRT2113429	hsa-miR-1260	CLIP-seq
MIRT2113430	hsa-miR-1260b	CLIP-seq
MIRT2113431	hsa-miR-1267	CLIP-seq
MIRT2113432	hsa-miR-1280	CLIP-seq
MIRT2113433	hsa-miR-129-5p	CLIP-seq
MIRT2113434	hsa-miR-1301	CLIP-seq
MIRT2113435	hsa-miR-1303	CLIP-seq
MIRT2113436	hsa-miR-153	CLIP-seq
MIRT2113437	hsa-miR-199a-5p	CLIP-seq
MIRT2113438	hsa-miR-199b-5p	CLIP-seq
MIRT2113439	hsa-miR-224	CLIP-seq
MIRT2113440	hsa-miR-3120-3p	CLIP-seq
MIRT2113441	hsa-miR-3158-3p	CLIP-seq
MIRT2113442	hsa-miR-3176	CLIP-seq
MIRT2113443	hsa-miR-330-3p	CLIP-seq
MIRT2113444	hsa-miR-3613-3p	CLIP-seq
MIRT2113445	hsa-miR-3660	CLIP-seq
MIRT2113446	hsa-miR-3675-3p	CLIP-seq
MIRT2113447	hsa-miR-3682-3p	CLIP-seq
MIRT2113448	hsa-miR-3919	CLIP-seq
MIRT2113449	hsa-miR-3922-3p	CLIP-seq
MIRT2113450	hsa-miR-3977	CLIP-seq
MIRT2113451	hsa-miR-4264	CLIP-seq
MIRT2113452	hsa-miR-431	CLIP-seq
MIRT2113453	hsa-miR-4422	CLIP-seq
MIRT2113454	hsa-miR-4428	CLIP-seq
MIRT2113455	hsa-miR-448	CLIP-seq
MIRT2113456	hsa-miR-4526	CLIP-seq
MIRT2113457	hsa-miR-4660	CLIP-seq
MIRT2113458	hsa-miR-4668-3p	CLIP-seq
MIRT2113459	hsa-miR-4684-5p	CLIP-seq
MIRT2113460	hsa-miR-4711-5p	CLIP-seq
MIRT1379717	hsa-miR-4753-3p	CLIP-seq
MIRT1379718	hsa-miR-4760-5p	CLIP-seq
MIRT2113461	hsa-miR-4762-5p	CLIP-seq
MIRT2113462	hsa-miR-4766-5p	CLIP-seq
MIRT2113463	hsa-miR-4797-3p	CLIP-seq
MIRT2113464	hsa-miR-4797-5p	CLIP-seq
MIRT2113465	hsa-miR-485-3p	CLIP-seq
MIRT2113466	hsa-miR-487a	CLIP-seq
MIRT2113467	hsa-miR-488	CLIP-seq
MIRT2113468	hsa-miR-5047	CLIP-seq
MIRT2113469	hsa-miR-520d-5p	CLIP-seq
MIRT2113470	hsa-miR-524-5p	CLIP-seq
MIRT2113471	hsa-miR-548ae	CLIP-seq
MIRT2113472	hsa-miR-548aj	CLIP-seq
MIRT2113473	hsa-miR-548am	CLIP-seq
MIRT2113474	hsa-miR-548x	CLIP-seq
MIRT2113475	hsa-miR-576-5p	CLIP-seq
MIRT1379725	hsa-miR-593	CLIP-seq
MIRT2113476	hsa-miR-622	CLIP-seq
MIRT2113477	hsa-miR-647	CLIP-seq
MIRT2113478	hsa-miR-942	CLIP-seq
MIRT2336449	hsa-miR-1	CLIP-seq
MIRT1379664	hsa-miR-100	CLIP-seq
MIRT1379666	hsa-miR-1179	CLIP-seq
MIRT2113425	hsa-miR-1184	CLIP-seq
MIRT1379667	hsa-miR-1185	CLIP-seq
MIRT2113426	hsa-miR-1224-3p	CLIP-seq
MIRT1379668	hsa-miR-1224-5p	CLIP-seq
MIRT2113427	hsa-miR-1236	CLIP-seq
MIRT2336450	hsa-miR-1246	CLIP-seq
MIRT2113428	hsa-miR-1256	CLIP-seq
MIRT2113429	hsa-miR-1260	CLIP-seq
MIRT2113430	hsa-miR-1260b	CLIP-seq
MIRT2336451	hsa-miR-1271	CLIP-seq
MIRT2336452	hsa-miR-1278	CLIP-seq
MIRT2336453	hsa-miR-128	CLIP-seq
MIRT2113432	hsa-miR-1280	CLIP-seq
MIRT2113433	hsa-miR-129-5p	CLIP-seq
MIRT2113434	hsa-miR-1301	CLIP-seq
MIRT2113435	hsa-miR-1303	CLIP-seq
MIRT1379672	hsa-miR-1304	CLIP-seq
MIRT1553938	hsa-miR-1324	CLIP-seq
MIRT2336454	hsa-miR-1343	CLIP-seq
MIRT2113436	hsa-miR-153	CLIP-seq
MIRT1379674	hsa-miR-183	CLIP-seq
MIRT2113437	hsa-miR-199a-5p	CLIP-seq
MIRT2113438	hsa-miR-199b-5p	CLIP-seq
MIRT2336455	hsa-miR-2053	CLIP-seq
MIRT2336456	hsa-miR-2054	CLIP-seq
MIRT2336457	hsa-miR-206	CLIP-seq
MIRT2336458	hsa-miR-22	CLIP-seq
MIRT2336459	hsa-miR-27a	CLIP-seq
MIRT2336460	hsa-miR-27b	CLIP-seq
MIRT2336461	hsa-miR-3074-3p	CLIP-seq
MIRT2336462	hsa-miR-3115	CLIP-seq
MIRT2336463	hsa-miR-3124-3p	CLIP-seq
MIRT2336464	hsa-miR-3134	CLIP-seq
MIRT2336465	hsa-miR-3145-5p	CLIP-seq
MIRT2336466	hsa-miR-3154	CLIP-seq
MIRT2336467	hsa-miR-3179	CLIP-seq
MIRT2336468	hsa-miR-3182	CLIP-seq
MIRT2336469	hsa-miR-329	CLIP-seq
MIRT2336470	hsa-miR-337-3p	CLIP-seq
MIRT1379684	hsa-miR-338-3p	CLIP-seq
MIRT1379685	hsa-miR-3605-5p	CLIP-seq
MIRT2336471	hsa-miR-3612	CLIP-seq
MIRT2336472	hsa-miR-362-3p	CLIP-seq
MIRT2113446	hsa-miR-3675-3p	CLIP-seq
MIRT1379689	hsa-miR-3679-5p	CLIP-seq
MIRT2336473	hsa-miR-3689a-3p	CLIP-seq
MIRT2336474	hsa-miR-3689c	CLIP-seq
MIRT2336475	hsa-miR-3690	CLIP-seq
MIRT1379690	hsa-miR-3714	CLIP-seq
MIRT1379692	hsa-miR-371b-5p	CLIP-seq
MIRT2336476	hsa-miR-384	CLIP-seq
MIRT1379694	hsa-miR-3915	CLIP-seq
MIRT1379695	hsa-miR-3936	CLIP-seq
MIRT2336477	hsa-miR-3941	CLIP-seq
MIRT1553939	hsa-miR-3942-3p	CLIP-seq
MIRT2336478	hsa-miR-423-3p	CLIP-seq
MIRT2336479	hsa-miR-4254	CLIP-seq
MIRT2113451	hsa-miR-4264	CLIP-seq
MIRT2336480	hsa-miR-4276	CLIP-seq
MIRT1379698	hsa-miR-4283	CLIP-seq
MIRT2336481	hsa-miR-4302	CLIP-seq
MIRT2113452	hsa-miR-431	CLIP-seq
MIRT1379699	hsa-miR-4310	CLIP-seq
MIRT2336482	hsa-miR-4318	CLIP-seq
MIRT1553940	hsa-miR-4320	CLIP-seq
MIRT2113453	hsa-miR-4422	CLIP-seq
MIRT2113454	hsa-miR-4428	CLIP-seq
MIRT2336483	hsa-miR-4434	CLIP-seq
MIRT1379702	hsa-miR-4437	CLIP-seq
MIRT1379704	hsa-miR-4470	CLIP-seq
MIRT2113455	hsa-miR-448	CLIP-seq
MIRT1379709	hsa-miR-4509	CLIP-seq
MIRT2336484	hsa-miR-450b-5p	CLIP-seq
MIRT2336485	hsa-miR-4516	CLIP-seq
MIRT1379711	hsa-miR-4530	CLIP-seq
MIRT1379712	hsa-miR-4643	CLIP-seq
MIRT2336486	hsa-miR-4652-3p	CLIP-seq
MIRT2113457	hsa-miR-4660	CLIP-seq
MIRT1379713	hsa-miR-4689	CLIP-seq
MIRT2336487	hsa-miR-4693-5p	CLIP-seq
MIRT2336488	hsa-miR-4698	CLIP-seq
MIRT2336489	hsa-miR-4711-3p	CLIP-seq
MIRT2336490	hsa-miR-4728-5p	CLIP-seq
MIRT2113461	hsa-miR-4762-5p	CLIP-seq
MIRT2113462	hsa-miR-4766-5p	CLIP-seq
MIRT2336491	hsa-miR-4782-5p	CLIP-seq
MIRT2113463	hsa-miR-4797-3p	CLIP-seq
MIRT2113464	hsa-miR-4797-5p	CLIP-seq
MIRT2113467	hsa-miR-488	CLIP-seq
MIRT2336492	hsa-miR-498	CLIP-seq
MIRT2113468	hsa-miR-5047	CLIP-seq
MIRT2336493	hsa-miR-507	CLIP-seq
MIRT1379720	hsa-miR-508-5p	CLIP-seq
MIRT2113469	hsa-miR-520d-5p	CLIP-seq
MIRT2113470	hsa-miR-524-5p	CLIP-seq
MIRT1379721	hsa-miR-548m	CLIP-seq
MIRT1379722	hsa-miR-555	CLIP-seq
MIRT2336494	hsa-miR-557	CLIP-seq
MIRT2336495	hsa-miR-603	CLIP-seq
MIRT2336496	hsa-miR-605	CLIP-seq
MIRT2336497	hsa-miR-613	CLIP-seq
MIRT2113476	hsa-miR-622	CLIP-seq
MIRT2113477	hsa-miR-647	CLIP-seq
MIRT2336498	hsa-miR-650	CLIP-seq
MIRT1379727	hsa-miR-766	CLIP-seq
MIRT2336499	hsa-miR-892a	CLIP-seq
MIRT2336500	hsa-miR-96	CLIP-seq
MIRT1379729	hsa-miR-99a	CLIP-seq
MIRT1379730	hsa-miR-99b	CLIP-seq
MIRT2113436	hsa-miR-153	CLIP-seq
MIRT2113451	hsa-miR-4264	CLIP-seq
MIRT2113452	hsa-miR-431	CLIP-seq
MIRT2113455	hsa-miR-448	CLIP-seq
MIRT1379712	hsa-miR-4643	CLIP-seq
MIRT2394954	hsa-miR-4789-3p	CLIP-seq
MIRT2113463	hsa-miR-4797-3p	CLIP-seq
MIRT2113476	hsa-miR-622	CLIP-seq
MIRT2460251	hsa-miR-3120-5p	CLIP-seq
MIRT2460252	hsa-miR-4475	CLIP-seq
MIRT2460253	hsa-miR-4521	CLIP-seq
MIRT2113462	hsa-miR-4766-5p	CLIP-seq
MIRT2113467	hsa-miR-488	CLIP-seq
MIRT2113477	hsa-miR-647	CLIP-seq
MIRT2630269	hsa-miR-103a	CLIP-seq
MIRT2630270	hsa-miR-107	CLIP-seq
MIRT1379666	hsa-miR-1179	CLIP-seq
MIRT2630271	hsa-miR-1193	CLIP-seq
MIRT2113427	hsa-miR-1236	CLIP-seq
MIRT2630272	hsa-miR-1243	CLIP-seq
MIRT1379669	hsa-miR-1262	CLIP-seq
MIRT2630273	hsa-miR-1265	CLIP-seq
MIRT2336453	hsa-miR-128	CLIP-seq
MIRT1379671	hsa-miR-1293	CLIP-seq
MIRT2336454	hsa-miR-1343	CLIP-seq
MIRT2630274	hsa-miR-185	CLIP-seq
MIRT2630275	hsa-miR-186	CLIP-seq
MIRT2630276	hsa-miR-1913	CLIP-seq
MIRT2113437	hsa-miR-199a-5p	CLIP-seq
MIRT2113438	hsa-miR-199b-5p	CLIP-seq
MIRT2336456	hsa-miR-2054	CLIP-seq
MIRT2630277	hsa-miR-221	CLIP-seq
MIRT2630278	hsa-miR-222	CLIP-seq
MIRT2630279	hsa-miR-2392	CLIP-seq
MIRT2630280	hsa-miR-28-3p	CLIP-seq
MIRT2630281	hsa-miR-3074-5p	CLIP-seq
MIRT2630282	hsa-miR-3123	CLIP-seq
MIRT2630283	hsa-miR-3133	CLIP-seq
MIRT2630284	hsa-miR-3137	CLIP-seq
MIRT2630285	hsa-miR-3143	CLIP-seq
MIRT2630286	hsa-miR-3157-3p	CLIP-seq
MIRT2630287	hsa-miR-324-3p	CLIP-seq
MIRT2113443	hsa-miR-330-3p	CLIP-seq
MIRT2336470	hsa-miR-337-3p	CLIP-seq
MIRT1379686	hsa-miR-3614-5p	CLIP-seq
MIRT2630288	hsa-miR-3654	CLIP-seq
MIRT2630289	hsa-miR-3674	CLIP-seq
MIRT2336475	hsa-miR-3690	CLIP-seq
MIRT2630290	hsa-miR-369-3p	CLIP-seq
MIRT1379690	hsa-miR-3714	CLIP-seq
MIRT1379691	hsa-miR-371-5p	CLIP-seq
MIRT1379692	hsa-miR-371b-5p	CLIP-seq
MIRT2630291	hsa-miR-374c	CLIP-seq
MIRT2336477	hsa-miR-3941	CLIP-seq
MIRT1379697	hsa-miR-4253	CLIP-seq
MIRT2336479	hsa-miR-4254	CLIP-seq
MIRT2336481	hsa-miR-4302	CLIP-seq
MIRT2630292	hsa-miR-4303	CLIP-seq
MIRT2630293	hsa-miR-4306	CLIP-seq
MIRT1379699	hsa-miR-4310	CLIP-seq
MIRT2113453	hsa-miR-4422	CLIP-seq
MIRT1379703	hsa-miR-4447	CLIP-seq
MIRT1379705	hsa-miR-4472	CLIP-seq
MIRT1379706	hsa-miR-4483	CLIP-seq
MIRT1379707	hsa-miR-4488	CLIP-seq
MIRT1379708	hsa-miR-4493	CLIP-seq
MIRT2630294	hsa-miR-4519	CLIP-seq
MIRT2460253	hsa-miR-4521	CLIP-seq
MIRT2630295	hsa-miR-4639-3p	CLIP-seq
MIRT2630296	hsa-miR-4642	CLIP-seq
MIRT2630297	hsa-miR-4644	CLIP-seq
MIRT2630298	hsa-miR-4649-3p	CLIP-seq
MIRT2630299	hsa-miR-466	CLIP-seq
MIRT2630300	hsa-miR-4672	CLIP-seq
MIRT2630301	hsa-miR-4694-5p	CLIP-seq
MIRT1379714	hsa-miR-4697-5p	CLIP-seq
MIRT2336488	hsa-miR-4698	CLIP-seq
MIRT1379715	hsa-miR-4701-3p	CLIP-seq
MIRT2630302	hsa-miR-4727-5p	CLIP-seq
MIRT1379717	hsa-miR-4753-3p	CLIP-seq
MIRT2630303	hsa-miR-4755-3p	CLIP-seq
MIRT2630304	hsa-miR-4757-5p	CLIP-seq
MIRT1379718	hsa-miR-4760-5p	CLIP-seq
MIRT2630305	hsa-miR-4768-3p	CLIP-seq
MIRT2113464	hsa-miR-4797-5p	CLIP-seq
MIRT2630306	hsa-miR-4803	CLIP-seq
MIRT2630307	hsa-miR-495	CLIP-seq
MIRT2630308	hsa-miR-515-5p	CLIP-seq
MIRT2630309	hsa-miR-543	CLIP-seq
MIRT2630310	hsa-miR-544	CLIP-seq
MIRT2630311	hsa-miR-548aa	CLIP-seq
MIRT2630312	hsa-miR-550b	CLIP-seq
MIRT2113475	hsa-miR-576-5p	CLIP-seq
MIRT1379725	hsa-miR-593	CLIP-seq
MIRT2630313	hsa-miR-624	CLIP-seq
MIRT2630314	hsa-miR-643	CLIP-seq
MIRT2630315	hsa-miR-655	CLIP-seq
MIRT2630316	hsa-miR-665	CLIP-seq
MIRT2630317	hsa-miR-718	CLIP-seq
MIRT2630318	hsa-miR-875-3p	CLIP-seq
MIRT1379665	hsa-miR-101	CLIP-seq
MIRT2630269	hsa-miR-103a	CLIP-seq
MIRT2630270	hsa-miR-107	CLIP-seq
MIRT1379666	hsa-miR-1179	CLIP-seq
MIRT2630271	hsa-miR-1193	CLIP-seq
MIRT2113426	hsa-miR-1224-3p	CLIP-seq
MIRT2113427	hsa-miR-1236	CLIP-seq
MIRT2630272	hsa-miR-1243	CLIP-seq
MIRT2336450	hsa-miR-1246	CLIP-seq
MIRT2691750	hsa-miR-1253	CLIP-seq
MIRT2113429	hsa-miR-1260	CLIP-seq
MIRT2113430	hsa-miR-1260b	CLIP-seq
MIRT1379669	hsa-miR-1262	CLIP-seq
MIRT2630273	hsa-miR-1265	CLIP-seq
MIRT1379670	hsa-miR-1273f	CLIP-seq
MIRT2691751	hsa-miR-1273g	CLIP-seq
MIRT2336453	hsa-miR-128	CLIP-seq
MIRT2113432	hsa-miR-1280	CLIP-seq
MIRT1379671	hsa-miR-1293	CLIP-seq
MIRT1553938	hsa-miR-1324	CLIP-seq
MIRT2336454	hsa-miR-1343	CLIP-seq
MIRT2691752	hsa-miR-137	CLIP-seq
MIRT1379673	hsa-miR-144	CLIP-seq
MIRT2691753	hsa-miR-150	CLIP-seq
MIRT2630274	hsa-miR-185	CLIP-seq
MIRT2691754	hsa-miR-188-3p	CLIP-seq
MIRT2630276	hsa-miR-1913	CLIP-seq
MIRT2113437	hsa-miR-199a-5p	CLIP-seq
MIRT2113438	hsa-miR-199b-5p	CLIP-seq
MIRT2336456	hsa-miR-2054	CLIP-seq
MIRT2691755	hsa-miR-2115	CLIP-seq
MIRT2630277	hsa-miR-221	CLIP-seq
MIRT2630278	hsa-miR-222	CLIP-seq
MIRT2630279	hsa-miR-2392	CLIP-seq
MIRT2630280	hsa-miR-28-3p	CLIP-seq
MIRT2630281	hsa-miR-3074-5p	CLIP-seq
MIRT2336462	hsa-miR-3115	CLIP-seq
MIRT2630282	hsa-miR-3123	CLIP-seq
MIRT2691756	hsa-miR-3125	CLIP-seq
MIRT1379680	hsa-miR-3126-5p	CLIP-seq
MIRT2630284	hsa-miR-3137	CLIP-seq
MIRT2691757	hsa-miR-3138	CLIP-seq
MIRT2630285	hsa-miR-3143	CLIP-seq
MIRT2336465	hsa-miR-3145-5p	CLIP-seq
MIRT2691758	hsa-miR-3156-3p	CLIP-seq
MIRT2630286	hsa-miR-3157-3p	CLIP-seq
MIRT2691759	hsa-miR-320a	CLIP-seq
MIRT2691760	hsa-miR-320b	CLIP-seq
MIRT2691761	hsa-miR-320c	CLIP-seq
MIRT2691762	hsa-miR-320d	CLIP-seq
MIRT2630287	hsa-miR-324-3p	CLIP-seq
MIRT2113443	hsa-miR-330-3p	CLIP-seq
MIRT2113444	hsa-miR-3613-3p	CLIP-seq
MIRT1379686	hsa-miR-3614-5p	CLIP-seq
MIRT1379687	hsa-miR-3622b-5p	CLIP-seq
MIRT2630288	hsa-miR-3654	CLIP-seq
MIRT2630289	hsa-miR-3674	CLIP-seq
MIRT2113446	hsa-miR-3675-3p	CLIP-seq
MIRT2336475	hsa-miR-3690	CLIP-seq
MIRT1379690	hsa-miR-3714	CLIP-seq
MIRT1379691	hsa-miR-371-5p	CLIP-seq
MIRT1379692	hsa-miR-371b-5p	CLIP-seq
MIRT2691763	hsa-miR-3916	CLIP-seq
MIRT1379695	hsa-miR-3936	CLIP-seq
MIRT2336477	hsa-miR-3941	CLIP-seq
MIRT1553939	hsa-miR-3942-3p	CLIP-seq
MIRT2113450	hsa-miR-3977	CLIP-seq
MIRT1379697	hsa-miR-4253	CLIP-seq
MIRT2336479	hsa-miR-4254	CLIP-seq
MIRT2691764	hsa-miR-4275	CLIP-seq
MIRT2691765	hsa-miR-4282	CLIP-seq
MIRT1379698	hsa-miR-4283	CLIP-seq
MIRT2691766	hsa-miR-4284	CLIP-seq
MIRT2336481	hsa-miR-4302	CLIP-seq
MIRT2630293	hsa-miR-4306	CLIP-seq
MIRT1379699	hsa-miR-4310	CLIP-seq
MIRT1553940	hsa-miR-4320	CLIP-seq
MIRT1379701	hsa-miR-4419a	CLIP-seq
MIRT2113453	hsa-miR-4422	CLIP-seq
MIRT2691767	hsa-miR-4429	CLIP-seq
MIRT2691768	hsa-miR-4433	CLIP-seq
MIRT1379702	hsa-miR-4437	CLIP-seq
MIRT1379703	hsa-miR-4447	CLIP-seq
MIRT1379704	hsa-miR-4470	CLIP-seq
MIRT1379705	hsa-miR-4472	CLIP-seq
MIRT1379706	hsa-miR-4483	CLIP-seq
MIRT1379707	hsa-miR-4488	CLIP-seq
MIRT2691769	hsa-miR-4491	CLIP-seq
MIRT1379708	hsa-miR-4493	CLIP-seq
MIRT1379710	hsa-miR-4510	CLIP-seq
MIRT2630294	hsa-miR-4519	CLIP-seq
MIRT2460253	hsa-miR-4521	CLIP-seq
MIRT2630295	hsa-miR-4639-3p	CLIP-seq
MIRT2630297	hsa-miR-4644	CLIP-seq
MIRT2691770	hsa-miR-4657	CLIP-seq
MIRT2630299	hsa-miR-466	CLIP-seq
MIRT2630300	hsa-miR-4672	CLIP-seq
MIRT2691771	hsa-miR-4688	CLIP-seq
MIRT2691772	hsa-miR-4694-3p	CLIP-seq
MIRT2630301	hsa-miR-4694-5p	CLIP-seq
MIRT1379714	hsa-miR-4697-5p	CLIP-seq
MIRT1379715	hsa-miR-4701-3p	CLIP-seq
MIRT1379716	hsa-miR-4710	CLIP-seq
MIRT2691773	hsa-miR-4713-5p	CLIP-seq
MIRT2691774	hsa-miR-4716-5p	CLIP-seq
MIRT2630302	hsa-miR-4727-5p	CLIP-seq
MIRT2691775	hsa-miR-4731-3p	CLIP-seq
MIRT1379717	hsa-miR-4753-3p	CLIP-seq
MIRT2630303	hsa-miR-4755-3p	CLIP-seq
MIRT2630304	hsa-miR-4757-5p	CLIP-seq
MIRT1379718	hsa-miR-4760-5p	CLIP-seq
MIRT2630305	hsa-miR-4768-3p	CLIP-seq
MIRT2336491	hsa-miR-4782-5p	CLIP-seq
MIRT2113464	hsa-miR-4797-5p	CLIP-seq
MIRT2691776	hsa-miR-4800-5p	CLIP-seq
MIRT2691777	hsa-miR-4801	CLIP-seq
MIRT2630307	hsa-miR-495	CLIP-seq
MIRT2691778	hsa-miR-516a-3p	CLIP-seq
MIRT2691779	hsa-miR-532-3p	CLIP-seq
MIRT2630309	hsa-miR-543	CLIP-seq
MIRT2630310	hsa-miR-544	CLIP-seq
MIRT2630311	hsa-miR-548aa	CLIP-seq
MIRT2691780	hsa-miR-548c-3p	CLIP-seq
MIRT2630312	hsa-miR-550b	CLIP-seq
MIRT1379722	hsa-miR-555	CLIP-seq
MIRT2113475	hsa-miR-576-5p	CLIP-seq
MIRT1379725	hsa-miR-593	CLIP-seq
MIRT2691781	hsa-miR-642b	CLIP-seq
MIRT2630314	hsa-miR-643	CLIP-seq
MIRT2630316	hsa-miR-665	CLIP-seq
MIRT1379726	hsa-miR-7	CLIP-seq
MIRT2630318	hsa-miR-875-3p	CLIP-seq
MIRT2691782	hsa-miR-889	CLIP-seq
MIRT2113478	hsa-miR-942	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0001540	Function	Amyloid-beta binding	IDA	24523320
GO:0001540	Function	Amyloid-beta binding	IPI	16407538
GO:0002024	Process	Diet induced thermogenesis	IEA
GO:0002024	Process	Diet induced thermogenesis	ISS
GO:0004888	Function	Transmembrane signaling receptor activity	IDA	11294867
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	9157966
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IEA
GO:0005041	Function	Low-density lipoprotein particle receptor activity	TAS	20005821
GO:0005515	Function	Protein binding	IPI	11294867, 11821067, 14764453, 16174740, 16407538, 17326667, 17855360, 21385844, 21994944, 23333276, 24001769, 25643321, 26053850, 26858303, 28265003, 28514442, 30448281, 30679749, 32296183, 32814053, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IDA	14764453
GO:0005615	Component	Extracellular space	IEA
GO:0005641	Component	Nuclear envelope lumen	IDA	17855360, 21989385
GO:0005641	Component	Nuclear envelope lumen	IEA
GO:0005768	Component	Endosome	IDA	16174740, 21385844
GO:0005768	Component	Endosome	IEA
GO:0005769	Component	Early endosome	IDA	21385844, 24001769
GO:0005769	Component	Early endosome	IMP	22621900
GO:0005771	Component	Multivesicular body	IDA	21385844
GO:0005771	Component	Multivesicular body	IEA
GO:0005783	Component	Endoplasmic reticulum	IDA	17855360, 21385844
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005794	Component	Golgi apparatus	IBA
GO:0005794	Component	Golgi apparatus	IDA	11294867, 16174740, 21385844, 21994944
GO:0005794	Component	Golgi apparatus	IEA
GO:0005802	Component	Trans-Golgi network	IDA	24001769
GO:0005829	Component	Cytosol	IEA
GO:0005886	Component	Plasma membrane	IDA	21385844, 21994944
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	9157966
GO:0006605	Process	Protein targeting	IDA	16407538, 21385844, 27322061
GO:0006605	Process	Protein targeting	IEA
GO:0006605	Process	Protein targeting	IMP	16174740
GO:0006622	Process	Protein targeting to lysosome	IBA
GO:0006622	Process	Protein targeting to lysosome	IDA	24523320
GO:0006892	Process	Post-Golgi vesicle-mediated transport	IBA
GO:0006892	Process	Post-Golgi vesicle-mediated transport	IDA	17855360
GO:0006897	Process	Endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IDA	11294867
GO:0006898	Process	Receptor-mediated endocytosis	TAS	9157966
GO:0007218	Process	Neuropeptide signaling pathway	IDA	11294867
GO:0009986	Component	Cell surface	IDA	11294867
GO:0010008	Component	Endosome membrane	IEA
GO:0010008	Component	Endosome membrane	TAS
GO:0010897	Process	Negative regulation of triglyceride catabolic process	IEA
GO:0010897	Process	Negative regulation of triglyceride catabolic process	ISS
GO:0014910	Process	Regulation of smooth muscle cell migration	IDA	14764453
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IDA	14764453
GO:0016020	Component	Membrane	IEA
GO:0016477	Process	Cell migration	IEA
GO:0019828	Function	Aspartic-type endopeptidase inhibitor activity	IDA	16407538
GO:0019828	Function	Aspartic-type endopeptidase inhibitor activity	IEA
GO:0019828	Function	Aspartic-type endopeptidase inhibitor activity	IMP	17855360, 21989385
GO:0030169	Function	Low-density lipoprotein particle binding	IPI	17326667
GO:0030514	Process	Negative regulation of BMP signaling pathway	IEA
GO:0030514	Process	Negative regulation of BMP signaling pathway	ISS
GO:0030658	Component	Transport vesicle membrane	IEA
GO:0031267	Function	Small GTPase binding	IPI	17855360
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	21989385
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031901	Component	Early endosome membrane	IDA	16174740
GO:0031901	Component	Early endosome membrane	IEA
GO:0031985	Component	Golgi cisterna	IDA	17855360
GO:0032585	Component	Multivesicular body membrane	IEA
GO:0034067	Process	Protein localization to Golgi apparatus	IDA	17855360
GO:0034205	Process	Amyloid-beta formation	IMP	26280335
GO:0038020	Process	Insulin receptor recycling	IDA	27322061
GO:0038020	Process	Insulin receptor recycling	IEA
GO:0042147	Process	Retrograde transport, endosome to Golgi	IDA	16174740
GO:0042923	Function	Neuropeptide binding	IPI	11082041, 11294867
GO:0043025	Component	Neuronal cell body	IEA
GO:0045053	Process	Protein retention in Golgi apparatus	IBA
GO:0045053	Process	Protein retention in Golgi apparatus	IDA	17855360
GO:0045053	Process	Protein retention in Golgi apparatus	IEA
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	24523320
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IDA	27322061
GO:0046628	Process	Positive regulation of insulin receptor signaling pathway	IEA
GO:0050768	Process	Negative regulation of neurogenesis	IEA
GO:0050768	Process	Negative regulation of neurogenesis	ISS
GO:0055037	Component	Recycling endosome	IMP	22621900
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0070863	Process	Positive regulation of protein exit from endoplasmic reticulum	IMP	17855360
GO:0097356	Component	Perinucleolar compartment	IEA
GO:0099638	Process	Endosome to plasma membrane protein transport	IEA
GO:0140318	Function	Protein transporter activity	IDA	16174740, 17855360
GO:1900168	Process	Positive regulation of glial cell-derived neurotrophic factor production	IDA	21994944
GO:1900168	Process	Positive regulation of glial cell-derived neurotrophic factor production	IEA
GO:1902430	Process	Negative regulation of amyloid-beta formation	IDA	16174740, 16407538, 22621900
GO:1902430	Process	Negative regulation of amyloid-beta formation	IEA
GO:1902430	Process	Negative regulation of amyloid-beta formation	IMP	17855360, 21989385, 24001769, 24523320
GO:1902953	Process	Positive regulation of ER to Golgi vesicle-mediated transport	IMP	17855360
GO:1902955	Process	Positive regulation of early endosome to recycling endosome transport	IMP	22621900
GO:1902966	Process	Positive regulation of protein localization to early endosome	IMP	22621900
GO:1902992	Process	Negative regulation of amyloid precursor protein catabolic process	IDA	16407538
GO:1902992	Process	Negative regulation of amyloid precursor protein catabolic process	IEA
GO:1902992	Process	Negative regulation of amyloid precursor protein catabolic process	IMP	17855360, 21989385
GO:1902997	Process	Negative regulation of neurofibrillary tangle assembly	IEA
GO:1902997	Process	Negative regulation of neurofibrillary tangle assembly	ISS
GO:1904179	Process	Positive regulation of adipose tissue development	IDA	27322061
GO:1904179	Process	Positive regulation of adipose tissue development	IEA
GO:1990845	Process	Adaptive thermogenesis	IEA
GO:1990845	Process	Adaptive thermogenesis	ISS
GO:2001137	Process	Positive regulation of endocytic recycling	IMP	22621900

Other IDs

• MIM: 602005
• HGNC: 11185
• e!Ensembl: ENSG00000137642

Protein

• UniProt ID: Q92673
• Protein name: Sortilin-related receptor (Low-density lipoprotein receptor relative with 11 ligand-binding repeats) (LDLR relative with 11 ligand-binding repeats) (LR11) (SorLA-1) (Sorting protein-related receptor containing LDLR class A repeats) (SorLA)
• Protein function: Sorting receptor that directs several proteins to their correct location within the cell (Probable). Along with AP-1 complex, involved Golgi apparatus - endosome sorting (PubMed:17646382). Sorting receptor for APP, regulating its intracellular t
• PDB: 2DM4, 3G2S, 3G2T, 3WSX, 3WSY, 3WSZ, 7VT0
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15902	Sortilin-Vps10	133 → 586	Sortilin, neurotensin receptor 3,	Domain
  PF15901	Sortilin_C	588 → 752	Sortilin, neurotensin receptor 3, C-terminal	Domain
  PF00058	Ldl_recept_b	844 → 884	Low-density lipoprotein receptor repeat class B	Repeat
  PF00058	Ldl_recept_b	888 → 929	Low-density lipoprotein receptor repeat class B	Repeat
  PF00057	Ldl_recept_a	1076 → 1112	Low-density lipoprotein receptor domain class A	Repeat
  PF00057	Ldl_recept_a	1115 → 1153	Low-density lipoprotein receptor domain class A	Repeat
  PF00057	Ldl_recept_a	1156 → 1192	Low-density lipoprotein receptor domain class A	Repeat
  PF00057	Ldl_recept_a	1197 → 1235	Low-density lipoprotein receptor domain class A	Repeat
  PF00057	Ldl_recept_a	1233 → 1271	Low-density lipoprotein receptor domain class A	Repeat
  PF00057	Ldl_recept_a	1323 → 1359	Low-density lipoprotein receptor domain class A	Repeat
  PF00057	Ldl_recept_a	1366 → 1403	Low-density lipoprotein receptor domain class A	Repeat
  PF00057	Ldl_recept_a	1417 → 1453	Low-density lipoprotein receptor domain class A	Repeat
  PF00057	Ldl_recept_a	1469 → 1506	Low-density lipoprotein receptor domain class A	Repeat
  PF00057	Ldl_recept_a	1512 → 1549	Low-density lipoprotein receptor domain class A	Repeat
  PF00041	fn3	1556 → 1633	Fibronectin type III domain	Domain
  PF00041	fn3	1652 → 1735	Fibronectin type III domain	Domain
  PF00041	fn3	1933 → 2014	Fibronectin type III domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in brain (at protein level) (PubMed:16174740, PubMed:21147781, PubMed:9157966). Most abundant in the cerebellum, cerebral cortex and occipital pole; low levels in the putamen and thalamus (PubMed:16174740, PubMed:91579
• Sequence:

  MATRSSRRESRLPFLFTLVALLPPGALCEVWTQRLHGGSAPLPQDRGFLVVQGDPRELRL
  WARGDARGASRADEKPLRRKRSAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVAL
  ARDSLALARPKSSDVYVSYDYGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFA
  DAYAQYLWITFDFCNTLQGFSIPFRAADLLLHSKASNLLLGFDRSHPNKQLWKSDDFGQT
  WIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRSTDFFQSRENQEVILEEVRDF
  QLRDKYMFATKVVHLLGSEQQSSVQLWVSFGRKPMRAAQFVTRHPINEYYIADASEDQVF
  VCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGL
  QGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQR
  LSQLLNLQLRRMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYY
  TWGDHGGIITAIAQGMETNELKYSTNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIF
  GSNKENVHSWLILQVNATDALGVPCTENDYKLWSPSDERGNECLLGHKTVFKRRTPHATC
  FNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCVPDPEFSGKSYSPPVPCPVGS
  TYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAVRKSIYRYDLASGATE
  QLPLTGLRAAVALDFDYEHNCLYWSDLALDVIQRLCLNGSTGQEVIINSGLETVEALAFE
  PLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKP
  GIYRSNMDGSAAYHLVSEDVKWPNGISVDDQWIYWTDAYLECIERITFSGQQRSVILDNL
  PHPYAIAVFKNEIYWDDWSQLSIFRASKYSGSQMEILANQLTGLMDMKIFYKGKNTGSNA
  CVPRPCSLLCLPKANNSRSCRCPEDVSSSVLPSGDLMCDCPQGYQLKNNTCVKQENTCLR
  NQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLDTQFRCQESGTCIPLSYKCDL
  EDDCGDNSDESHCEMHQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEANCTAIYHTCE
  ASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNCEKKCNGFRCPNGTCIPSSKHCDGLR
  DCSDGSDEQHCEPLCTHFMDFVCKNRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQDPE
  FHKVCDEFGFQCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCENGH
  CIPNRWKCDRENDCGDWSDEKDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDG
  YRDCADGSDEEACPLLANVTAASTPTQLGRCDRFEFECHQPKTCIPNWKRCDGHQDCQDG
  RDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDCSDESDEKACSDELTVYKVQN
  LQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKTNTVLKVLKPD
  TTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPRNLQLSLPREAEGVIVGHWAPPIHTH
  GLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSI
  TTIKGKVIPPPDIHIDSYGENYLSFTLTMESDIKVNGYVVNLFWAFDTHKQERRTLNFRG
  SILSHKVGNLTAHTSYEISAWAKTDLGDSPLAFEHVMTRGVRPPAPSLKAKAINQTAVEC
  TWTGPRNVVYGIFYATSFLDLYRNPKSLTTSLHNKTVIVSKDEQYLFLVRVVVPYQGPSS
  DYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPDQDLLYAVAVKDLIRKTDRSY
  KVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDALKIITENDHVL
  LFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQAR
  CLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYT
  KHRRLQSSFTAFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA

• Sequence length: 2214

Pathways

Reactome:

Amyloid fiber formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Complex hereditary spastic paraplegia	Pathogenic	rs2496816791	RCV004574945	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Moyamoya angiopathy	Likely pathogenic	rs770704659	RCV004704481	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer disease 9	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMER DISEASE, FAMILIAL, 1	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS DEPENDENCE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITIVE DYSFUNCTION	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLICATED HEREDITARY SPASTIC PARAPLEGIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY-ONSET AUTOSOMAL DOMINANT ALZHEIMER DISEASE	—	GenCC, Orphanet GenCC, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Early-onset dementia of unclear type	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL ALZHEIMER DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glioma susceptibility 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATIC HEART DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SORL1-related disorder	Likely benign; Benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	22750733		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	22750733		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22750733		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17220890, 17420311, 17826910, 17903297, 17949987, 17975299, 18090307, 18562096, 18830724, 18938222, 19064752, 20634593, 21185108, 21280075, 21997402, 22508715, 22621900, 22673115, 22996644, 23318115, 23525328, 23595767, 23673467, 24166411, 24731980, 25365775, 25382023, 25525276, 25598427, 25723573, 25772071, 25842969, 26543236, 26996954, 27177090, 27328823, 27650968, 27779372, 27911290, 28034305, 28229235, 28322202, 28427149, 28537274, 28595629, 28634550, 28789839, 30077089, 30078640, 30412497, 31092209, 31405128, 31580390, 31585107, 32072450, 32183776, 32492427, 32749525, 32909371, 32986668, 33522999, 33720088, 33726851, 33737586, 33879716, 34092785, 34133918, 34506082, 34752346, 34922638, 34948429, 35210353, 35226190, 35383839, 35456392, 35457051, 35671596, 35761418, 35905044, 36191742, 36411364, 36573011, 36652482, 36750708, 37611586, 37895139, 37949073, 38244079, 40183375, 40528303	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease	Alzheimer disease	Pubtator	17721864, 19364929, 22927900	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	19822782, 22472873, 26303663, 27026413, 28527213, 28738127, 29480197, 31381512		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	17220890, 17826910, 17949987, 18160637, 18407551, 18713574, 19539718, 19822782, 20625269, 21185108, 22044026, 22996644, 23455993, 23525328, 23565137, 24309291, 25382023, 25450149, 25598427, 26627482, 26873856, 27023435, 27779372, 27911290, 28427149, 28527213, 31585107		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	UNIPROT_DG	21220680, 22472873, 23565137, 24523320		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	23565137, 24162737, 29777097, 30617256, 31473137		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	23565137, 24162737		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	19036982, 20625269, 24833601, 27177090		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	31405128	Associate	★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	11425040, 24284991, 26520897		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	40081680	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	11425040, 24284991, 26520897		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	30061737		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrophy	Atrophy	Pubtator	19064752, 27177090	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	25897833		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	25897833	Associate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	27177090		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	26520897		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	BEFREE	30550937		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	31092209		★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	Pubtator	31092209, 35457051	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	24938503, 27177090		★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	19064752		★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	19064752	Associate	★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	22750733		★☆☆☆☆ Found in Text Mining only
Cholestasis	Cholestasis	CTD_human_DG	26881866		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	17721864, 23673467, 25598427, 27779372, 34214049	Associate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	17721864, 28034305	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognitive Dysfunction	Cognition disorder	Pubtator	22927900	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	36553628	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	18541377, 19368828, 19653016, 29376855, 29567423		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	Pubtator	31836585, 34506082, 35457051, 36750708	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	29499509		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	20881129		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	20881129		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	18160637		★☆☆☆☆ Found in Text Mining only
Diffuse Cerebral Sclerosis of Schilder	Schilder disease	Pubtator	27779372	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	17826910, 20946940		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	17826910	Associate	★☆☆☆☆ Found in Text Mining only
Dysgraphia	Dysgraphia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Early-onset autosomal dominant Alzheimer disease	Alzheimer disease	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epiretinal Membrane	Epiretinal Membrane	BEFREE	28102455		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	16957580, 24523320, 28595629, 29376855		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	ORPHANET_DG	22472873		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	31405128, 33737586	Associate	★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	35474271	Associate	★☆☆☆☆ Found in Text Mining only
Homocystinuria	Homocystinuria	Pubtator	36553628	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	23977241		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia, Familial	Hypercholesterolemia	BEFREE	28637586		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type IIa	Hyperlipoproteinemia	BEFREE	26520897, 28637586		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	20667857		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27493099		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	23463934, 25598427, 27005436		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	CTD_human_DG	30503753		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Language Disorders	Language development disorders	Pubtator	33737586	Associate	★☆☆☆☆ Found in Text Mining only
Language Disorders	Language Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24699135	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	22750733		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	31405128, 34948429, 36191742	Associate	★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	33720088	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31138794		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	31138794		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	37205232	Associate	★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	17903297	Associate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	29499509		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	22286501, 23609762, 24083537, 24166411, 24486888, 25881907, 28034305, 30983028		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	CTD_human_DG	30503753		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	35692878	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	27811368		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	27811368	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	19285134		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11425040		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	19064752, 22545106, 27177090, 31405128, 31580390, 34506082, 35752680	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30679749		★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Alzheimer disease	Alzheimer disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	26584636, 27322061		★☆☆☆☆ Found in Text Mining only
Oculomotor apraxia	Oculomotor apraxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Oculovestibuloauditory syndrome	Oculovestibuloauditory Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	29567423		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31405128, 33879716, 34506082, 34948429, 36553628	Associate	★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	30061737		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	19653016, 29376855, 29567423		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	21093110	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27493099		★☆☆☆☆ Found in Text Mining only
Sarcopenia	Sarcopenia	Pubtator	40081680	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	25897833		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	25897833	Associate	★☆☆☆☆ Found in Text Mining only
Semantic Dementia	Semantic Dementia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	19364929, 20625269		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	35464477	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	17903297	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	19064752		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	19064752	Associate	★☆☆☆☆ Found in Text Mining only