Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6648
Gene name	Superoxide dismutase 2
Gene symbol	SOD2
Synonyms (NCBI Gene)	GC1GClnc1IPO-BIPOBMNSODMVCD6Mn-SODlncRNA-GC1
Chromosome	6
Chromosome location	6q25.3
Summary	This gene is a member of the iron/manganese superoxide dismutase family. It encodes a mitochondrial protein that forms a homotetramer and binds one manganese ion per subunit. This protein binds to the superoxide byproducts of oxidative phosphorylation and

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs4880	A>G	Drug-response, risk-factor, benign	Coding sequence variant, 5 prime UTR variant, missense variant

1369

Show/Hide all (1369)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000993	hsa-miR-377-3p	Luciferase reporter assayWestern blot	18716028
MIRT000135	hsa-miR-222-3p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	19487542
MIRT005745	hsa-miR-17-3p	Luciferase reporter assayQuantitative proteomic approachWestern blot	21203553
MIRT028409	hsa-miR-30a-5p	Proteomics	18668040
MIRT043729	hsa-miR-342-3p	CLASH	23622248
MIRT039083	hsa-miR-769-3p	CLASH	23622248
MIRT437838	hsa-miR-212-3p	Luciferase reporter assay	23583431
MIRT437838	hsa-miR-212-3p	Luciferase reporter assay	23583431
MIRT689910	hsa-miR-4282	HITS-CLIP	23313552
MIRT689909	hsa-miR-3120-3p	HITS-CLIP	23313552
MIRT689908	hsa-miR-181c-3p	HITS-CLIP	23313552
MIRT689907	hsa-miR-5586-3p	HITS-CLIP	23313552
MIRT689906	hsa-miR-548p	HITS-CLIP	23313552
MIRT689905	hsa-miR-6871-5p	HITS-CLIP	23313552
MIRT689904	hsa-miR-4698	HITS-CLIP	23313552
MIRT689903	hsa-miR-4714-3p	HITS-CLIP	23313552
MIRT689902	hsa-miR-759	HITS-CLIP	23313552
MIRT689901	hsa-miR-545-3p	HITS-CLIP	23313552
MIRT689900	hsa-miR-4742-5p	HITS-CLIP	23313552
MIRT689899	hsa-miR-1283	HITS-CLIP	23313552
MIRT689898	hsa-miR-3130-3p	HITS-CLIP	23313552
MIRT689897	hsa-miR-4793-3p	HITS-CLIP	23313552
MIRT689896	hsa-miR-548aj-5p	HITS-CLIP	23313552
MIRT689895	hsa-miR-548g-5p	HITS-CLIP	23313552
MIRT689894	hsa-miR-548x-5p	HITS-CLIP	23313552
MIRT689893	hsa-miR-6878-5p	HITS-CLIP	23313552
MIRT689892	hsa-miR-6731-5p	HITS-CLIP	23313552
MIRT689891	hsa-miR-8085	HITS-CLIP	23313552
MIRT689890	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT689889	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT689888	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT689887	hsa-miR-544a	HITS-CLIP	23313552
MIRT689886	hsa-miR-4445-3p	HITS-CLIP	23313552
MIRT689885	hsa-miR-548aa	HITS-CLIP	23313552
MIRT689884	hsa-miR-548ap-3p	HITS-CLIP	23313552
MIRT689883	hsa-miR-548t-3p	HITS-CLIP	23313552
MIRT689882	hsa-miR-5683	HITS-CLIP	23313552
MIRT689881	hsa-miR-1285-5p	HITS-CLIP	23313552
MIRT689880	hsa-miR-4709-5p	HITS-CLIP	23313552
MIRT689879	hsa-miR-421	HITS-CLIP	23313552
MIRT689878	hsa-miR-200a-5p	HITS-CLIP	23313552
MIRT689877	hsa-miR-200b-5p	HITS-CLIP	23313552
MIRT689876	hsa-miR-4272	HITS-CLIP	23313552
MIRT689875	hsa-miR-610	HITS-CLIP	23313552
MIRT689874	hsa-miR-7159-5p	HITS-CLIP	23313552
MIRT689873	hsa-miR-505-3p	HITS-CLIP	23313552
MIRT689872	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT689871	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT689870	hsa-miR-8080	HITS-CLIP	23313552
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT642825	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT642824	hsa-miR-5189-3p	HITS-CLIP	23824327
MIRT642823	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT642822	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT642821	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT642820	hsa-miR-23c	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT617350	hsa-miR-614	HITS-CLIP	23824327
MIRT617349	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT617348	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT617350	hsa-miR-614	HITS-CLIP	23824327
MIRT617349	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT617348	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT503383	hsa-miR-501-3p	PAR-CLIP	20371350
MIRT503382	hsa-miR-502-3p	PAR-CLIP	20371350
MIRT503381	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT503378	hsa-miR-6804-3p	PAR-CLIP	20371350
MIRT503379	hsa-miR-7977	PAR-CLIP	20371350
MIRT503377	hsa-miR-500a-3p	PAR-CLIP	20371350
MIRT559933	hsa-miR-4302	PAR-CLIP	20371350
MIRT559932	hsa-miR-4289	PAR-CLIP	20371350
MIRT559931	hsa-miR-145-3p	PAR-CLIP	20371350
MIRT559930	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT559929	hsa-miR-6077	PAR-CLIP	20371350
MIRT559928	hsa-miR-6717-5p	PAR-CLIP	20371350
MIRT559927	hsa-miR-8053	PAR-CLIP	20371350
MIRT559926	hsa-miR-3190-3p	PAR-CLIP	20371350
MIRT559925	hsa-miR-644a	PAR-CLIP	20371350
MIRT559924	hsa-miR-6833-5p	PAR-CLIP	20371350
MIRT559923	hsa-miR-4752	PAR-CLIP	20371350
MIRT559922	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT451859	hsa-miR-583	PAR-CLIP	20371350
MIRT498677	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT451862	hsa-miR-3125	PAR-CLIP	20371350
MIRT451861	hsa-miR-3916	PAR-CLIP	20371350
MIRT451860	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT559921	hsa-miR-339-5p	PAR-CLIP	20371350
MIRT451858	hsa-miR-6124	PAR-CLIP	20371350
MIRT559920	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT559919	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT503383	hsa-miR-501-3p	PAR-CLIP	21572407
MIRT503382	hsa-miR-502-3p	PAR-CLIP	21572407
MIRT503381	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT503380	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT549775	hsa-miR-4459	PAR-CLIP	21572407
MIRT549774	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT503378	hsa-miR-6804-3p	PAR-CLIP	21572407
MIRT503379	hsa-miR-7977	PAR-CLIP	21572407
MIRT503377	hsa-miR-500a-3p	PAR-CLIP	21572407
MIRT451881	hsa-miR-3914	PAR-CLIP	21572407
MIRT451880	hsa-miR-1265	PAR-CLIP	21572407
MIRT451879	hsa-miR-4491	PAR-CLIP	21572407
MIRT451878	hsa-miR-4657	PAR-CLIP	21572407
MIRT451877	hsa-miR-764	PAR-CLIP	21572407
MIRT451876	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT451875	hsa-miR-3605-5p	PAR-CLIP	21572407
MIRT451874	hsa-miR-3135b	PAR-CLIP	21572407
MIRT451873	hsa-miR-1287-5p	PAR-CLIP	21572407
MIRT451871	hsa-miR-4434	PAR-CLIP	21572407
MIRT451872	hsa-miR-4516	PAR-CLIP	21572407
MIRT451870	hsa-miR-5703	PAR-CLIP	21572407
MIRT451869	hsa-miR-185-5p	PAR-CLIP	21572407
MIRT451868	hsa-miR-4306	PAR-CLIP	21572407
MIRT451867	hsa-miR-4644	PAR-CLIP	21572407
MIRT451866	hsa-miR-5192	PAR-CLIP	21572407
MIRT451865	hsa-miR-4764-5p	PAR-CLIP	21572407
MIRT451864	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT451863	hsa-miR-4531	PAR-CLIP	21572407
MIRT451881	hsa-miR-3914	PAR-CLIP	21572407
MIRT451880	hsa-miR-1265	PAR-CLIP	21572407
MIRT451879	hsa-miR-4491	PAR-CLIP	21572407
MIRT451878	hsa-miR-4657	PAR-CLIP	21572407
MIRT451877	hsa-miR-764	PAR-CLIP	21572407
MIRT451876	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT451875	hsa-miR-3605-5p	PAR-CLIP	21572407
MIRT451874	hsa-miR-3135b	PAR-CLIP	21572407
MIRT451873	hsa-miR-1287-5p	PAR-CLIP	21572407
MIRT451871	hsa-miR-4434	PAR-CLIP	21572407
MIRT451872	hsa-miR-4516	PAR-CLIP	21572407
MIRT451870	hsa-miR-5703	PAR-CLIP	21572407
MIRT451869	hsa-miR-185-5p	PAR-CLIP	21572407
MIRT451868	hsa-miR-4306	PAR-CLIP	21572407
MIRT451867	hsa-miR-4644	PAR-CLIP	21572407
MIRT451866	hsa-miR-5192	PAR-CLIP	21572407
MIRT451865	hsa-miR-4764-5p	PAR-CLIP	21572407
MIRT451864	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT451863	hsa-miR-4531	PAR-CLIP	21572407
MIRT525813	hsa-miR-551b-5p	PAR-CLIP	22012620
MIRT525812	hsa-miR-3159	PAR-CLIP	22012620
MIRT525811	hsa-miR-885-5p	PAR-CLIP	22012620
MIRT525810	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT525809	hsa-miR-6861-5p	PAR-CLIP	22012620
MIRT525808	hsa-miR-503-3p	PAR-CLIP	22012620
MIRT525807	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT525806	hsa-miR-6758-3p	PAR-CLIP	22012620
MIRT525805	hsa-miR-4786-3p	PAR-CLIP	22012620
MIRT525804	hsa-miR-4695-3p	PAR-CLIP	22012620
MIRT525803	hsa-miR-4713-3p	PAR-CLIP	22012620
MIRT525802	hsa-miR-638	PAR-CLIP	22012620
MIRT525801	hsa-miR-450b-3p	PAR-CLIP	22012620
MIRT039083	hsa-miR-769-3p	PAR-CLIP	22012620
MIRT525800	hsa-miR-4476	PAR-CLIP	22012620
MIRT525799	hsa-miR-6876-5p	PAR-CLIP	22012620
MIRT525798	hsa-miR-490-5p	PAR-CLIP	22012620
MIRT525797	hsa-miR-5191	PAR-CLIP	22012620
MIRT525796	hsa-miR-6816-3p	PAR-CLIP	22012620
MIRT525795	hsa-miR-3123	PAR-CLIP	22012620
MIRT525794	hsa-miR-6757-5p	PAR-CLIP	22012620
MIRT525793	hsa-miR-6515-3p	PAR-CLIP	22012620
MIRT525792	hsa-miR-6861-3p	PAR-CLIP	22012620
MIRT525791	hsa-miR-561-5p	PAR-CLIP	22012620
MIRT525790	hsa-miR-3611	PAR-CLIP	22012620
MIRT525789	hsa-miR-2116-3p	PAR-CLIP	22012620
MIRT525788	hsa-miR-1236-5p	PAR-CLIP	22012620
MIRT525787	hsa-miR-4765	PAR-CLIP	22012620
MIRT525786	hsa-miR-513b-5p	PAR-CLIP	22012620
MIRT525785	hsa-miR-4678	PAR-CLIP	22012620
MIRT525784	hsa-miR-425-5p	PAR-CLIP	22012620
MIRT525783	hsa-miR-5681b	PAR-CLIP	22012620
MIRT525782	hsa-miR-331-5p	PAR-CLIP	22012620
MIRT525781	hsa-miR-183-3p	PAR-CLIP	22012620
MIRT525780	hsa-miR-1302	PAR-CLIP	22012620
MIRT525779	hsa-miR-4298	PAR-CLIP	22012620
MIRT525778	hsa-miR-6509-5p	PAR-CLIP	22012620
MIRT451853	hsa-miR-6749-3p	PAR-CLIP	22012620
MIRT525777	hsa-miR-3121-3p	PAR-CLIP	22012620
MIRT525776	hsa-miR-10a-3p	PAR-CLIP	22012620
MIRT525775	hsa-miR-577	PAR-CLIP	22012620
MIRT525774	hsa-miR-3690	PAR-CLIP	22012620
MIRT525773	hsa-miR-4254	PAR-CLIP	22012620
MIRT525772	hsa-miR-6508-5p	PAR-CLIP	22012620
MIRT525771	hsa-miR-8067	PAR-CLIP	22012620
MIRT525770	hsa-miR-4638-3p	PAR-CLIP	22012620
MIRT525769	hsa-miR-1343-3p	PAR-CLIP	22012620
MIRT525768	hsa-miR-6783-3p	PAR-CLIP	22012620
MIRT525767	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT439567	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT525766	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT439566	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT525765	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT525764	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT525763	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT525762	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT525761	hsa-miR-3681-5p	PAR-CLIP	22012620
MIRT525760	hsa-miR-6849-5p	PAR-CLIP	22012620
MIRT525759	hsa-miR-142-5p	PAR-CLIP	22012620
MIRT525758	hsa-miR-5590-3p	PAR-CLIP	22012620
MIRT525757	hsa-miR-144-5p	PAR-CLIP	22012620
MIRT525756	hsa-miR-376b-5p	PAR-CLIP	22012620
MIRT525755	hsa-miR-376c-5p	PAR-CLIP	22012620
MIRT525754	hsa-miR-3671	PAR-CLIP	22012620
MIRT525753	hsa-miR-4803	PAR-CLIP	22012620
MIRT525752	hsa-miR-483-3p	PAR-CLIP	22012620
MIRT525752	hsa-miR-483-3p	PAR-CLIP	22012620
MIRT525750	hsa-miR-146a-3p	PAR-CLIP	22012620
MIRT525751	hsa-miR-301a-5p	PAR-CLIP	22012620
MIRT525749	hsa-miR-301b-5p	PAR-CLIP	22012620
MIRT525748	hsa-miR-593-3p	PAR-CLIP	22012620
MIRT525747	hsa-miR-4684-3p	PAR-CLIP	22012620
MIRT525746	hsa-miR-4474-5p	PAR-CLIP	22012620
MIRT525745	hsa-miR-9500	PAR-CLIP	22012620
MIRT498675	hsa-miR-4436b-3p	PAR-CLIP	22012620
MIRT498674	hsa-miR-4632-5p	PAR-CLIP	22012620
MIRT498673	hsa-miR-6735-5p	PAR-CLIP	22012620
MIRT498672	hsa-miR-6879-5p	PAR-CLIP	22012620
MIRT498671	hsa-miR-7843-5p	PAR-CLIP	22012620
MIRT525744	hsa-miR-125b-1-3p	PAR-CLIP	22012620
MIRT525743	hsa-miR-519d-5p	PAR-CLIP	22012620
MIRT525742	hsa-miR-6730-5p	PAR-CLIP	22012620
MIRT498670	hsa-miR-203a-3p	PAR-CLIP	22012620
MIRT498668	hsa-miR-3148	PAR-CLIP	22012620
MIRT525741	hsa-miR-671-5p	PAR-CLIP	22012620
MIRT525740	hsa-miR-409-5p	PAR-CLIP	22012620
MIRT498667	hsa-miR-6892-5p	PAR-CLIP	22012620
MIRT525739	hsa-miR-520d-5p	PAR-CLIP	22012620
MIRT525738	hsa-miR-524-5p	PAR-CLIP	22012620
MIRT525737	hsa-miR-5591-3p	PAR-CLIP	22012620
MIRT498666	hsa-miR-197-3p	PAR-CLIP	22012620
MIRT525736	hsa-miR-518a-5p	PAR-CLIP	22012620
MIRT525735	hsa-miR-527	PAR-CLIP	22012620
MIRT525734	hsa-miR-1911-3p	PAR-CLIP	22012620
MIRT525733	hsa-miR-6753-5p	PAR-CLIP	22012620
MIRT525731	hsa-miR-7162-3p	PAR-CLIP	22012620
MIRT525732	hsa-let-7a-5p	PAR-CLIP	22012620
MIRT525730	hsa-let-7b-5p	PAR-CLIP	22012620
MIRT525729	hsa-let-7c-5p	PAR-CLIP	22012620
MIRT525728	hsa-let-7d-5p	PAR-CLIP	22012620
MIRT525727	hsa-let-7e-5p	PAR-CLIP	22012620
MIRT525726	hsa-let-7f-5p	PAR-CLIP	22012620
MIRT525725	hsa-let-7g-5p	PAR-CLIP	22012620
MIRT525724	hsa-let-7i-5p	PAR-CLIP	22012620
MIRT525723	hsa-miR-4458	PAR-CLIP	22012620
MIRT525722	hsa-miR-4500	PAR-CLIP	22012620
MIRT525721	hsa-miR-98-5p	PAR-CLIP	22012620
MIRT525720	hsa-miR-202-3p	PAR-CLIP	22012620
MIRT167960	hsa-miR-4325	PAR-CLIP	22012620
MIRT498676	hsa-miR-3646	PAR-CLIP	23446348
MIRT514700	hsa-miR-1252-3p	PAR-CLIP	23446348
MIRT514699	hsa-miR-1179	PAR-CLIP	23446348
MIRT514698	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT514697	hsa-miR-875-5p	PAR-CLIP	23446348
MIRT514696	hsa-miR-4495	PAR-CLIP	23446348
MIRT514695	hsa-miR-4424	PAR-CLIP	23446348
MIRT514694	hsa-miR-3944-5p	PAR-CLIP	23446348
MIRT514693	hsa-miR-633	PAR-CLIP	23446348
MIRT514692	hsa-miR-4266	PAR-CLIP	23446348
MIRT514691	hsa-miR-3144-3p	PAR-CLIP	23446348
MIRT451881	hsa-miR-3914	PAR-CLIP	23446348
MIRT451880	hsa-miR-1265	PAR-CLIP	23446348
MIRT451879	hsa-miR-4491	PAR-CLIP	23446348
MIRT451878	hsa-miR-4657	PAR-CLIP	23446348
MIRT451877	hsa-miR-764	PAR-CLIP	23446348
MIRT451876	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT451875	hsa-miR-3605-5p	PAR-CLIP	23446348
MIRT451874	hsa-miR-3135b	PAR-CLIP	23446348
MIRT451873	hsa-miR-1287-5p	PAR-CLIP	23446348
MIRT451871	hsa-miR-4434	PAR-CLIP	23446348
MIRT451872	hsa-miR-4516	PAR-CLIP	23446348
MIRT451870	hsa-miR-5703	PAR-CLIP	23446348
MIRT451869	hsa-miR-185-5p	PAR-CLIP	23446348
MIRT451868	hsa-miR-4306	PAR-CLIP	23446348
MIRT451867	hsa-miR-4644	PAR-CLIP	23446348
MIRT451866	hsa-miR-5192	PAR-CLIP	23446348
MIRT451865	hsa-miR-4764-5p	PAR-CLIP	23446348
MIRT451864	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT451863	hsa-miR-4531	PAR-CLIP	23446348
MIRT451881	hsa-miR-3914	PAR-CLIP	23446348
MIRT451880	hsa-miR-1265	PAR-CLIP	23446348
MIRT451879	hsa-miR-4491	PAR-CLIP	23446348
MIRT451878	hsa-miR-4657	PAR-CLIP	23446348
MIRT451877	hsa-miR-764	PAR-CLIP	23446348
MIRT451876	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT451875	hsa-miR-3605-5p	PAR-CLIP	23446348
MIRT451874	hsa-miR-3135b	PAR-CLIP	23446348
MIRT451873	hsa-miR-1287-5p	PAR-CLIP	23446348
MIRT451871	hsa-miR-4434	PAR-CLIP	23446348
MIRT451872	hsa-miR-4516	PAR-CLIP	23446348
MIRT451870	hsa-miR-5703	PAR-CLIP	23446348
MIRT451869	hsa-miR-185-5p	PAR-CLIP	23446348
MIRT451868	hsa-miR-4306	PAR-CLIP	23446348
MIRT451867	hsa-miR-4644	PAR-CLIP	23446348
MIRT451866	hsa-miR-5192	PAR-CLIP	23446348
MIRT451865	hsa-miR-4764-5p	PAR-CLIP	23446348
MIRT451864	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT451863	hsa-miR-4531	PAR-CLIP	23446348
MIRT451893	hsa-miR-4780	PAR-CLIP	23446348
MIRT451892	hsa-miR-6780b-3p	PAR-CLIP	23446348
MIRT451890	hsa-miR-3659	PAR-CLIP	23446348
MIRT451891	hsa-miR-623	PAR-CLIP	23446348
MIRT451889	hsa-miR-204-5p	PAR-CLIP	23446348
MIRT451888	hsa-miR-211-5p	PAR-CLIP	23446348
MIRT451887	hsa-miR-4755-5p	PAR-CLIP	23446348
MIRT451886	hsa-miR-5006-3p	PAR-CLIP	23446348
MIRT451885	hsa-miR-7159-3p	PAR-CLIP	23446348
MIRT451884	hsa-miR-4482-3p	PAR-CLIP	23446348
MIRT451883	hsa-miR-4446-5p	PAR-CLIP	23446348
MIRT503383	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT503382	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT503381	hsa-miR-892c-5p	PAR-CLIP	23446348
MIRT503380	hsa-miR-506-5p	PAR-CLIP	23446348
MIRT503378	hsa-miR-6804-3p	PAR-CLIP	23446348
MIRT503379	hsa-miR-7977	PAR-CLIP	23446348
MIRT503377	hsa-miR-500a-3p	PAR-CLIP	23446348
MIRT451881	hsa-miR-3914	PAR-CLIP	24398324
MIRT451880	hsa-miR-1265	PAR-CLIP	24398324
MIRT451879	hsa-miR-4491	PAR-CLIP	24398324
MIRT451878	hsa-miR-4657	PAR-CLIP	24398324
MIRT451876	hsa-miR-539-5p	PAR-CLIP	24398324
MIRT451875	hsa-miR-3605-5p	PAR-CLIP	24398324
MIRT451874	hsa-miR-3135b	PAR-CLIP	24398324
MIRT451873	hsa-miR-1287-5p	PAR-CLIP	24398324
MIRT451871	hsa-miR-4434	PAR-CLIP	24398324
MIRT451872	hsa-miR-4516	PAR-CLIP	24398324
MIRT451870	hsa-miR-5703	PAR-CLIP	24398324
MIRT451869	hsa-miR-185-5p	PAR-CLIP	24398324
MIRT451868	hsa-miR-4306	PAR-CLIP	24398324
MIRT451867	hsa-miR-4644	PAR-CLIP	24398324
MIRT451866	hsa-miR-5192	PAR-CLIP	24398324
MIRT451865	hsa-miR-4764-5p	PAR-CLIP	24398324
MIRT451864	hsa-miR-7847-3p	PAR-CLIP	24398324
MIRT451863	hsa-miR-4531	PAR-CLIP	24398324
MIRT498676	hsa-miR-3646	PAR-CLIP	24398324
MIRT498677	hsa-miR-651-3p	PAR-CLIP	24398324
MIRT498675	hsa-miR-4436b-3p	PAR-CLIP	24398324
MIRT498674	hsa-miR-4632-5p	PAR-CLIP	24398324
MIRT498673	hsa-miR-6735-5p	PAR-CLIP	24398324
MIRT498672	hsa-miR-6879-5p	PAR-CLIP	24398324
MIRT498671	hsa-miR-7843-5p	PAR-CLIP	24398324
MIRT498670	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT498669	hsa-miR-1252-5p	PAR-CLIP	24398324
MIRT498668	hsa-miR-3148	PAR-CLIP	24398324
MIRT498667	hsa-miR-6892-5p	PAR-CLIP	24398324
MIRT498666	hsa-miR-197-3p	PAR-CLIP	24398324
MIRT451893	hsa-miR-4780	PAR-CLIP	23592263
MIRT451892	hsa-miR-6780b-3p	PAR-CLIP	23592263
MIRT451890	hsa-miR-3659	PAR-CLIP	23592263
MIRT451891	hsa-miR-623	PAR-CLIP	23592263
MIRT451889	hsa-miR-204-5p	PAR-CLIP	23592263
MIRT451888	hsa-miR-211-5p	PAR-CLIP	23592263
MIRT451887	hsa-miR-4755-5p	PAR-CLIP	23592263
MIRT451886	hsa-miR-5006-3p	PAR-CLIP	23592263
MIRT451885	hsa-miR-7159-3p	PAR-CLIP	23592263
MIRT451884	hsa-miR-4482-3p	PAR-CLIP	23592263
MIRT451883	hsa-miR-4446-5p	PAR-CLIP	23592263
MIRT451882	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT451881	hsa-miR-3914	PAR-CLIP	23592263
MIRT451880	hsa-miR-1265	PAR-CLIP	23592263
MIRT451879	hsa-miR-4491	PAR-CLIP	23592263
MIRT451878	hsa-miR-4657	PAR-CLIP	23592263
MIRT451877	hsa-miR-764	PAR-CLIP	23592263
MIRT451876	hsa-miR-539-5p	PAR-CLIP	23592263
MIRT451875	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT451874	hsa-miR-3135b	PAR-CLIP	23592263
MIRT451873	hsa-miR-1287-5p	PAR-CLIP	23592263
MIRT451871	hsa-miR-4434	PAR-CLIP	23592263
MIRT451872	hsa-miR-4516	PAR-CLIP	23592263
MIRT451870	hsa-miR-5703	PAR-CLIP	23592263
MIRT451869	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT451868	hsa-miR-4306	PAR-CLIP	23592263
MIRT451867	hsa-miR-4644	PAR-CLIP	23592263
MIRT451866	hsa-miR-5192	PAR-CLIP	23592263
MIRT451865	hsa-miR-4764-5p	PAR-CLIP	23592263
MIRT451864	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT451863	hsa-miR-4531	PAR-CLIP	23592263
MIRT451862	hsa-miR-3125	PAR-CLIP	23592263
MIRT451861	hsa-miR-3916	PAR-CLIP	23592263
MIRT451860	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT451858	hsa-miR-6124	PAR-CLIP	23592263
MIRT451859	hsa-miR-583	PAR-CLIP	23592263
MIRT451857	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT451856	hsa-miR-6826-5p	PAR-CLIP	23592263
MIRT451855	hsa-miR-6731-3p	PAR-CLIP	23592263
MIRT451854	hsa-miR-4738-3p	PAR-CLIP	23592263
MIRT451853	hsa-miR-6749-3p	PAR-CLIP	23592263
MIRT442905	hsa-miR-936	PAR-CLIP	22100165
MIRT442903	hsa-miR-199a-3p	PAR-CLIP	22100165
MIRT442902	hsa-miR-199b-3p	PAR-CLIP	22100165
MIRT442901	hsa-miR-3129-5p	PAR-CLIP	22100165
MIRT442900	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT442899	hsa-miR-222-5p	PAR-CLIP	22100165
MIRT439567	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439566	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439567	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT525766	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT525765	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT525762	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT525764	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439566	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT005745	hsa-miR-17-3p	qRT-PCRWestern blot	27505139
MIRT525750	hsa-miR-146a-3p	Western blottingImmunofluorescenceqRT-PCRELISA	31416388
MIRT689910	hsa-miR-4282	HITS-CLIP	23313552
MIRT689909	hsa-miR-3120-3p	HITS-CLIP	23313552
MIRT689908	hsa-miR-181c-3p	HITS-CLIP	23313552
MIRT689907	hsa-miR-5586-3p	HITS-CLIP	23313552
MIRT689906	hsa-miR-548p	HITS-CLIP	23313552
MIRT689905	hsa-miR-6871-5p	HITS-CLIP	23313552
MIRT689904	hsa-miR-4698	HITS-CLIP	23313552
MIRT689903	hsa-miR-4714-3p	HITS-CLIP	23313552
MIRT689902	hsa-miR-759	HITS-CLIP	23313552
MIRT689901	hsa-miR-545-3p	HITS-CLIP	23313552
MIRT689900	hsa-miR-4742-5p	HITS-CLIP	23313552
MIRT689899	hsa-miR-1283	HITS-CLIP	23313552
MIRT689898	hsa-miR-3130-3p	HITS-CLIP	23313552
MIRT689897	hsa-miR-4793-3p	HITS-CLIP	23313552
MIRT689896	hsa-miR-548aj-5p	HITS-CLIP	23313552
MIRT689895	hsa-miR-548g-5p	HITS-CLIP	23313552
MIRT689894	hsa-miR-548x-5p	HITS-CLIP	23313552
MIRT689893	hsa-miR-6878-5p	HITS-CLIP	23313552
MIRT689892	hsa-miR-6731-5p	HITS-CLIP	23313552
MIRT689891	hsa-miR-8085	HITS-CLIP	23313552
MIRT689890	hsa-miR-30c-1-3p	HITS-CLIP	23313552
MIRT689889	hsa-miR-30c-2-3p	HITS-CLIP	23313552
MIRT689888	hsa-miR-6788-5p	HITS-CLIP	23313552
MIRT689887	hsa-miR-544a	HITS-CLIP	23313552
MIRT689886	hsa-miR-4445-3p	HITS-CLIP	23313552
MIRT689885	hsa-miR-548aa	HITS-CLIP	23313552
MIRT689884	hsa-miR-548ap-3p	HITS-CLIP	23313552
MIRT689883	hsa-miR-548t-3p	HITS-CLIP	23313552
MIRT689882	hsa-miR-5683	HITS-CLIP	23313552
MIRT689881	hsa-miR-1285-5p	HITS-CLIP	23313552
MIRT689880	hsa-miR-4709-5p	HITS-CLIP	23313552
MIRT689879	hsa-miR-421	HITS-CLIP	23313552
MIRT689878	hsa-miR-200a-5p	HITS-CLIP	23313552
MIRT689877	hsa-miR-200b-5p	HITS-CLIP	23313552
MIRT689876	hsa-miR-4272	HITS-CLIP	23313552
MIRT689875	hsa-miR-610	HITS-CLIP	23313552
MIRT689874	hsa-miR-7159-5p	HITS-CLIP	23313552
MIRT689873	hsa-miR-505-3p	HITS-CLIP	23313552
MIRT689872	hsa-miR-548as-3p	HITS-CLIP	23313552
MIRT689871	hsa-miR-6771-3p	HITS-CLIP	23313552
MIRT689870	hsa-miR-8080	HITS-CLIP	23313552
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT642825	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT642824	hsa-miR-5189-3p	HITS-CLIP	23824327
MIRT642823	hsa-miR-130a-5p	HITS-CLIP	23824327
MIRT642822	hsa-miR-23a-3p	HITS-CLIP	23824327
MIRT642821	hsa-miR-23b-3p	HITS-CLIP	23824327
MIRT642820	hsa-miR-23c	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT617350	hsa-miR-614	HITS-CLIP	23824327
MIRT617349	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT617348	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT617350	hsa-miR-614	HITS-CLIP	23824327
MIRT617349	hsa-miR-410-3p	HITS-CLIP	23824327
MIRT617348	hsa-miR-4668-5p	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT609374	hsa-miR-8485	HITS-CLIP	23824327
MIRT609373	hsa-miR-329-3p	HITS-CLIP	23824327
MIRT609372	hsa-miR-362-3p	HITS-CLIP	23824327
MIRT609371	hsa-miR-603	HITS-CLIP	23824327
MIRT609370	hsa-miR-4789-3p	HITS-CLIP	23824327
MIRT609369	hsa-miR-9-5p	HITS-CLIP	23824327
MIRT609368	hsa-miR-5689	HITS-CLIP	23824327
MIRT609367	hsa-miR-3941	HITS-CLIP	23824327
MIRT609366	hsa-miR-150-3p	HITS-CLIP	23824327
MIRT609365	hsa-miR-1263	HITS-CLIP	23824327
MIRT503383	hsa-miR-501-3p	PAR-CLIP	20371350
MIRT503382	hsa-miR-502-3p	PAR-CLIP	20371350
MIRT503381	hsa-miR-892c-5p	PAR-CLIP	20371350
MIRT503378	hsa-miR-6804-3p	PAR-CLIP	20371350
MIRT503379	hsa-miR-7977	PAR-CLIP	20371350
MIRT503377	hsa-miR-500a-3p	PAR-CLIP	20371350
MIRT559933	hsa-miR-4302	PAR-CLIP	20371350
MIRT559932	hsa-miR-4289	PAR-CLIP	20371350
MIRT559931	hsa-miR-145-3p	PAR-CLIP	20371350
MIRT559930	hsa-miR-7-5p	PAR-CLIP	20371350
MIRT559929	hsa-miR-6077	PAR-CLIP	20371350
MIRT559928	hsa-miR-6717-5p	PAR-CLIP	20371350
MIRT559927	hsa-miR-8053	PAR-CLIP	20371350
MIRT559926	hsa-miR-3190-3p	PAR-CLIP	20371350
MIRT559925	hsa-miR-644a	PAR-CLIP	20371350
MIRT559924	hsa-miR-6833-5p	PAR-CLIP	20371350
MIRT559923	hsa-miR-4752	PAR-CLIP	20371350
MIRT559922	hsa-miR-670-3p	PAR-CLIP	20371350
MIRT451859	hsa-miR-583	PAR-CLIP	20371350
MIRT498677	hsa-miR-651-3p	PAR-CLIP	20371350
MIRT451862	hsa-miR-3125	PAR-CLIP	20371350
MIRT451861	hsa-miR-3916	PAR-CLIP	20371350
MIRT451860	hsa-miR-6859-5p	PAR-CLIP	20371350
MIRT559921	hsa-miR-339-5p	PAR-CLIP	20371350
MIRT451858	hsa-miR-6124	PAR-CLIP	20371350
MIRT559920	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT559919	hsa-miR-4646-3p	PAR-CLIP	20371350
MIRT503383	hsa-miR-501-3p	PAR-CLIP	21572407
MIRT503382	hsa-miR-502-3p	PAR-CLIP	21572407
MIRT503381	hsa-miR-892c-5p	PAR-CLIP	21572407
MIRT503380	hsa-miR-506-5p	PAR-CLIP	21572407
MIRT549775	hsa-miR-4459	PAR-CLIP	21572407
MIRT549774	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT503378	hsa-miR-6804-3p	PAR-CLIP	21572407
MIRT503379	hsa-miR-7977	PAR-CLIP	21572407
MIRT503377	hsa-miR-500a-3p	PAR-CLIP	21572407
MIRT451881	hsa-miR-3914	PAR-CLIP	21572407
MIRT451880	hsa-miR-1265	PAR-CLIP	21572407
MIRT451879	hsa-miR-4491	PAR-CLIP	21572407
MIRT451878	hsa-miR-4657	PAR-CLIP	21572407
MIRT451877	hsa-miR-764	PAR-CLIP	21572407
MIRT451876	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT451875	hsa-miR-3605-5p	PAR-CLIP	21572407
MIRT451874	hsa-miR-3135b	PAR-CLIP	21572407
MIRT451873	hsa-miR-1287-5p	PAR-CLIP	21572407
MIRT451871	hsa-miR-4434	PAR-CLIP	21572407
MIRT451872	hsa-miR-4516	PAR-CLIP	21572407
MIRT451870	hsa-miR-5703	PAR-CLIP	21572407
MIRT451869	hsa-miR-185-5p	PAR-CLIP	21572407
MIRT451868	hsa-miR-4306	PAR-CLIP	21572407
MIRT451867	hsa-miR-4644	PAR-CLIP	21572407
MIRT451866	hsa-miR-5192	PAR-CLIP	21572407
MIRT451865	hsa-miR-4764-5p	PAR-CLIP	21572407
MIRT451864	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT451863	hsa-miR-4531	PAR-CLIP	21572407
MIRT451881	hsa-miR-3914	PAR-CLIP	21572407
MIRT451880	hsa-miR-1265	PAR-CLIP	21572407
MIRT451879	hsa-miR-4491	PAR-CLIP	21572407
MIRT451878	hsa-miR-4657	PAR-CLIP	21572407
MIRT451877	hsa-miR-764	PAR-CLIP	21572407
MIRT451876	hsa-miR-539-5p	PAR-CLIP	21572407
MIRT451875	hsa-miR-3605-5p	PAR-CLIP	21572407
MIRT451874	hsa-miR-3135b	PAR-CLIP	21572407
MIRT451873	hsa-miR-1287-5p	PAR-CLIP	21572407
MIRT451871	hsa-miR-4434	PAR-CLIP	21572407
MIRT451872	hsa-miR-4516	PAR-CLIP	21572407
MIRT451870	hsa-miR-5703	PAR-CLIP	21572407
MIRT451869	hsa-miR-185-5p	PAR-CLIP	21572407
MIRT451868	hsa-miR-4306	PAR-CLIP	21572407
MIRT451867	hsa-miR-4644	PAR-CLIP	21572407
MIRT451866	hsa-miR-5192	PAR-CLIP	21572407
MIRT451865	hsa-miR-4764-5p	PAR-CLIP	21572407
MIRT451864	hsa-miR-7847-3p	PAR-CLIP	21572407
MIRT451863	hsa-miR-4531	PAR-CLIP	21572407
MIRT525813	hsa-miR-551b-5p	PAR-CLIP	22012620
MIRT525812	hsa-miR-3159	PAR-CLIP	22012620
MIRT525811	hsa-miR-885-5p	PAR-CLIP	22012620
MIRT525810	hsa-miR-186-3p	PAR-CLIP	22012620
MIRT525809	hsa-miR-6861-5p	PAR-CLIP	22012620
MIRT525808	hsa-miR-503-3p	PAR-CLIP	22012620
MIRT525807	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT525806	hsa-miR-6758-3p	PAR-CLIP	22012620
MIRT525805	hsa-miR-4786-3p	PAR-CLIP	22012620
MIRT525804	hsa-miR-4695-3p	PAR-CLIP	22012620
MIRT525803	hsa-miR-4713-3p	PAR-CLIP	22012620
MIRT525802	hsa-miR-638	PAR-CLIP	22012620
MIRT525801	hsa-miR-450b-3p	PAR-CLIP	22012620
MIRT039083	hsa-miR-769-3p	PAR-CLIP	22012620
MIRT525800	hsa-miR-4476	PAR-CLIP	22012620
MIRT525799	hsa-miR-6876-5p	PAR-CLIP	22012620
MIRT525798	hsa-miR-490-5p	PAR-CLIP	22012620
MIRT525797	hsa-miR-5191	PAR-CLIP	22012620
MIRT525796	hsa-miR-6816-3p	PAR-CLIP	22012620
MIRT525795	hsa-miR-3123	PAR-CLIP	22012620
MIRT525794	hsa-miR-6757-5p	PAR-CLIP	22012620
MIRT525793	hsa-miR-6515-3p	PAR-CLIP	22012620
MIRT525792	hsa-miR-6861-3p	PAR-CLIP	22012620
MIRT525791	hsa-miR-561-5p	PAR-CLIP	22012620
MIRT525790	hsa-miR-3611	PAR-CLIP	22012620
MIRT525789	hsa-miR-2116-3p	PAR-CLIP	22012620
MIRT525788	hsa-miR-1236-5p	PAR-CLIP	22012620
MIRT525787	hsa-miR-4765	PAR-CLIP	22012620
MIRT525786	hsa-miR-513b-5p	PAR-CLIP	22012620
MIRT525785	hsa-miR-4678	PAR-CLIP	22012620
MIRT525784	hsa-miR-425-5p	PAR-CLIP	22012620
MIRT525783	hsa-miR-5681b	PAR-CLIP	22012620
MIRT525782	hsa-miR-331-5p	PAR-CLIP	22012620
MIRT525781	hsa-miR-183-3p	PAR-CLIP	22012620
MIRT525780	hsa-miR-1302	PAR-CLIP	22012620
MIRT525779	hsa-miR-4298	PAR-CLIP	22012620
MIRT525778	hsa-miR-6509-5p	PAR-CLIP	22012620
MIRT451853	hsa-miR-6749-3p	PAR-CLIP	22012620
MIRT525777	hsa-miR-3121-3p	PAR-CLIP	22012620
MIRT525776	hsa-miR-10a-3p	PAR-CLIP	22012620
MIRT525775	hsa-miR-577	PAR-CLIP	22012620
MIRT525774	hsa-miR-3690	PAR-CLIP	22012620
MIRT525773	hsa-miR-4254	PAR-CLIP	22012620
MIRT525772	hsa-miR-6508-5p	PAR-CLIP	22012620
MIRT525771	hsa-miR-8067	PAR-CLIP	22012620
MIRT525770	hsa-miR-4638-3p	PAR-CLIP	22012620
MIRT525769	hsa-miR-1343-3p	PAR-CLIP	22012620
MIRT525768	hsa-miR-6783-3p	PAR-CLIP	22012620
MIRT525767	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT439567	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT525766	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT439566	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT525765	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT525764	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT525763	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT525762	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT525761	hsa-miR-3681-5p	PAR-CLIP	22012620
MIRT525760	hsa-miR-6849-5p	PAR-CLIP	22012620
MIRT525759	hsa-miR-142-5p	PAR-CLIP	22012620
MIRT525758	hsa-miR-5590-3p	PAR-CLIP	22012620
MIRT525757	hsa-miR-144-5p	PAR-CLIP	22012620
MIRT525756	hsa-miR-376b-5p	PAR-CLIP	22012620
MIRT525755	hsa-miR-376c-5p	PAR-CLIP	22012620
MIRT525754	hsa-miR-3671	PAR-CLIP	22012620
MIRT525753	hsa-miR-4803	PAR-CLIP	22012620
MIRT525752	hsa-miR-483-3p	PAR-CLIP	22012620
MIRT525752	hsa-miR-483-3p	PAR-CLIP	22012620
MIRT525750	hsa-miR-146a-3p	PAR-CLIP	22012620
MIRT525751	hsa-miR-301a-5p	PAR-CLIP	22012620
MIRT525749	hsa-miR-301b-5p	PAR-CLIP	22012620
MIRT525748	hsa-miR-593-3p	PAR-CLIP	22012620
MIRT525747	hsa-miR-4684-3p	PAR-CLIP	22012620
MIRT525746	hsa-miR-4474-5p	PAR-CLIP	22012620
MIRT525745	hsa-miR-9500	PAR-CLIP	22012620
MIRT498675	hsa-miR-4436b-3p	PAR-CLIP	22012620
MIRT498674	hsa-miR-4632-5p	PAR-CLIP	22012620
MIRT498673	hsa-miR-6735-5p	PAR-CLIP	22012620
MIRT498672	hsa-miR-6879-5p	PAR-CLIP	22012620
MIRT498671	hsa-miR-7843-5p	PAR-CLIP	22012620
MIRT525744	hsa-miR-125b-1-3p	PAR-CLIP	22012620
MIRT525743	hsa-miR-519d-5p	PAR-CLIP	22012620
MIRT525742	hsa-miR-6730-5p	PAR-CLIP	22012620
MIRT498670	hsa-miR-203a-3p	PAR-CLIP	22012620
MIRT498668	hsa-miR-3148	PAR-CLIP	22012620
MIRT525741	hsa-miR-671-5p	PAR-CLIP	22012620
MIRT525740	hsa-miR-409-5p	PAR-CLIP	22012620
MIRT498667	hsa-miR-6892-5p	PAR-CLIP	22012620
MIRT525739	hsa-miR-520d-5p	PAR-CLIP	22012620
MIRT525738	hsa-miR-524-5p	PAR-CLIP	22012620
MIRT525737	hsa-miR-5591-3p	PAR-CLIP	22012620
MIRT498666	hsa-miR-197-3p	PAR-CLIP	22012620
MIRT525736	hsa-miR-518a-5p	PAR-CLIP	22012620
MIRT525735	hsa-miR-527	PAR-CLIP	22012620
MIRT525734	hsa-miR-1911-3p	PAR-CLIP	22012620
MIRT525733	hsa-miR-6753-5p	PAR-CLIP	22012620
MIRT525731	hsa-miR-7162-3p	PAR-CLIP	22012620
MIRT525732	hsa-let-7a-5p	PAR-CLIP	22012620
MIRT525730	hsa-let-7b-5p	PAR-CLIP	22012620
MIRT525729	hsa-let-7c-5p	PAR-CLIP	22012620
MIRT525728	hsa-let-7d-5p	PAR-CLIP	22012620
MIRT525727	hsa-let-7e-5p	PAR-CLIP	22012620
MIRT525726	hsa-let-7f-5p	PAR-CLIP	22012620
MIRT525725	hsa-let-7g-5p	PAR-CLIP	22012620
MIRT525724	hsa-let-7i-5p	PAR-CLIP	22012620
MIRT525723	hsa-miR-4458	PAR-CLIP	22012620
MIRT525722	hsa-miR-4500	PAR-CLIP	22012620
MIRT525721	hsa-miR-98-5p	PAR-CLIP	22012620
MIRT525720	hsa-miR-202-3p	PAR-CLIP	22012620
MIRT167960	hsa-miR-4325	PAR-CLIP	22012620
MIRT498676	hsa-miR-3646	PAR-CLIP	23446348
MIRT514700	hsa-miR-1252-3p	PAR-CLIP	23446348
MIRT514699	hsa-miR-1179	PAR-CLIP	23446348
MIRT514698	hsa-miR-6888-5p	PAR-CLIP	23446348
MIRT514697	hsa-miR-875-5p	PAR-CLIP	23446348
MIRT514696	hsa-miR-4495	PAR-CLIP	23446348
MIRT514695	hsa-miR-4424	PAR-CLIP	23446348
MIRT514694	hsa-miR-3944-5p	PAR-CLIP	23446348
MIRT514693	hsa-miR-633	PAR-CLIP	23446348
MIRT514692	hsa-miR-4266	PAR-CLIP	23446348
MIRT514691	hsa-miR-3144-3p	PAR-CLIP	23446348
MIRT451881	hsa-miR-3914	PAR-CLIP	23446348
MIRT451880	hsa-miR-1265	PAR-CLIP	23446348
MIRT451879	hsa-miR-4491	PAR-CLIP	23446348
MIRT451878	hsa-miR-4657	PAR-CLIP	23446348
MIRT451877	hsa-miR-764	PAR-CLIP	23446348
MIRT451876	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT451875	hsa-miR-3605-5p	PAR-CLIP	23446348
MIRT451874	hsa-miR-3135b	PAR-CLIP	23446348
MIRT451873	hsa-miR-1287-5p	PAR-CLIP	23446348
MIRT451871	hsa-miR-4434	PAR-CLIP	23446348
MIRT451872	hsa-miR-4516	PAR-CLIP	23446348
MIRT451870	hsa-miR-5703	PAR-CLIP	23446348
MIRT451869	hsa-miR-185-5p	PAR-CLIP	23446348
MIRT451868	hsa-miR-4306	PAR-CLIP	23446348
MIRT451867	hsa-miR-4644	PAR-CLIP	23446348
MIRT451866	hsa-miR-5192	PAR-CLIP	23446348
MIRT451865	hsa-miR-4764-5p	PAR-CLIP	23446348
MIRT451864	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT451863	hsa-miR-4531	PAR-CLIP	23446348
MIRT451881	hsa-miR-3914	PAR-CLIP	23446348
MIRT451880	hsa-miR-1265	PAR-CLIP	23446348
MIRT451879	hsa-miR-4491	PAR-CLIP	23446348
MIRT451878	hsa-miR-4657	PAR-CLIP	23446348
MIRT451877	hsa-miR-764	PAR-CLIP	23446348
MIRT451876	hsa-miR-539-5p	PAR-CLIP	23446348
MIRT451875	hsa-miR-3605-5p	PAR-CLIP	23446348
MIRT451874	hsa-miR-3135b	PAR-CLIP	23446348
MIRT451873	hsa-miR-1287-5p	PAR-CLIP	23446348
MIRT451871	hsa-miR-4434	PAR-CLIP	23446348
MIRT451872	hsa-miR-4516	PAR-CLIP	23446348
MIRT451870	hsa-miR-5703	PAR-CLIP	23446348
MIRT451869	hsa-miR-185-5p	PAR-CLIP	23446348
MIRT451868	hsa-miR-4306	PAR-CLIP	23446348
MIRT451867	hsa-miR-4644	PAR-CLIP	23446348
MIRT451866	hsa-miR-5192	PAR-CLIP	23446348
MIRT451865	hsa-miR-4764-5p	PAR-CLIP	23446348
MIRT451864	hsa-miR-7847-3p	PAR-CLIP	23446348
MIRT451863	hsa-miR-4531	PAR-CLIP	23446348
MIRT451893	hsa-miR-4780	PAR-CLIP	23446348
MIRT451892	hsa-miR-6780b-3p	PAR-CLIP	23446348
MIRT451890	hsa-miR-3659	PAR-CLIP	23446348
MIRT451891	hsa-miR-623	PAR-CLIP	23446348
MIRT451889	hsa-miR-204-5p	PAR-CLIP	23446348
MIRT451888	hsa-miR-211-5p	PAR-CLIP	23446348
MIRT451887	hsa-miR-4755-5p	PAR-CLIP	23446348
MIRT451886	hsa-miR-5006-3p	PAR-CLIP	23446348
MIRT451885	hsa-miR-7159-3p	PAR-CLIP	23446348
MIRT451884	hsa-miR-4482-3p	PAR-CLIP	23446348
MIRT451883	hsa-miR-4446-5p	PAR-CLIP	23446348
MIRT503383	hsa-miR-501-3p	PAR-CLIP	23446348
MIRT503382	hsa-miR-502-3p	PAR-CLIP	23446348
MIRT503381	hsa-miR-892c-5p	PAR-CLIP	23446348
MIRT503380	hsa-miR-506-5p	PAR-CLIP	23446348
MIRT503378	hsa-miR-6804-3p	PAR-CLIP	23446348
MIRT503379	hsa-miR-7977	PAR-CLIP	23446348
MIRT503377	hsa-miR-500a-3p	PAR-CLIP	23446348
MIRT451881	hsa-miR-3914	PAR-CLIP	24398324
MIRT451880	hsa-miR-1265	PAR-CLIP	24398324
MIRT451879	hsa-miR-4491	PAR-CLIP	24398324
MIRT451878	hsa-miR-4657	PAR-CLIP	24398324
MIRT451876	hsa-miR-539-5p	PAR-CLIP	24398324
MIRT451875	hsa-miR-3605-5p	PAR-CLIP	24398324
MIRT451874	hsa-miR-3135b	PAR-CLIP	24398324
MIRT451873	hsa-miR-1287-5p	PAR-CLIP	24398324
MIRT451871	hsa-miR-4434	PAR-CLIP	24398324
MIRT451872	hsa-miR-4516	PAR-CLIP	24398324
MIRT451870	hsa-miR-5703	PAR-CLIP	24398324
MIRT451869	hsa-miR-185-5p	PAR-CLIP	24398324
MIRT451868	hsa-miR-4306	PAR-CLIP	24398324
MIRT451867	hsa-miR-4644	PAR-CLIP	24398324
MIRT451866	hsa-miR-5192	PAR-CLIP	24398324
MIRT451865	hsa-miR-4764-5p	PAR-CLIP	24398324
MIRT451864	hsa-miR-7847-3p	PAR-CLIP	24398324
MIRT451863	hsa-miR-4531	PAR-CLIP	24398324
MIRT498676	hsa-miR-3646	PAR-CLIP	24398324
MIRT498677	hsa-miR-651-3p	PAR-CLIP	24398324
MIRT498675	hsa-miR-4436b-3p	PAR-CLIP	24398324
MIRT498674	hsa-miR-4632-5p	PAR-CLIP	24398324
MIRT498673	hsa-miR-6735-5p	PAR-CLIP	24398324
MIRT498672	hsa-miR-6879-5p	PAR-CLIP	24398324
MIRT498671	hsa-miR-7843-5p	PAR-CLIP	24398324
MIRT498670	hsa-miR-203a-3p	PAR-CLIP	24398324
MIRT498669	hsa-miR-1252-5p	PAR-CLIP	24398324
MIRT498668	hsa-miR-3148	PAR-CLIP	24398324
MIRT498667	hsa-miR-6892-5p	PAR-CLIP	24398324
MIRT498666	hsa-miR-197-3p	PAR-CLIP	24398324
MIRT451893	hsa-miR-4780	PAR-CLIP	23592263
MIRT451892	hsa-miR-6780b-3p	PAR-CLIP	23592263
MIRT451890	hsa-miR-3659	PAR-CLIP	23592263
MIRT451891	hsa-miR-623	PAR-CLIP	23592263
MIRT451889	hsa-miR-204-5p	PAR-CLIP	23592263
MIRT451888	hsa-miR-211-5p	PAR-CLIP	23592263
MIRT451887	hsa-miR-4755-5p	PAR-CLIP	23592263
MIRT451886	hsa-miR-5006-3p	PAR-CLIP	23592263
MIRT451885	hsa-miR-7159-3p	PAR-CLIP	23592263
MIRT451884	hsa-miR-4482-3p	PAR-CLIP	23592263
MIRT451883	hsa-miR-4446-5p	PAR-CLIP	23592263
MIRT451882	hsa-miR-552-3p	PAR-CLIP	23592263
MIRT451881	hsa-miR-3914	PAR-CLIP	23592263
MIRT451880	hsa-miR-1265	PAR-CLIP	23592263
MIRT451879	hsa-miR-4491	PAR-CLIP	23592263
MIRT451878	hsa-miR-4657	PAR-CLIP	23592263
MIRT451877	hsa-miR-764	PAR-CLIP	23592263
MIRT451876	hsa-miR-539-5p	PAR-CLIP	23592263
MIRT451875	hsa-miR-3605-5p	PAR-CLIP	23592263
MIRT451874	hsa-miR-3135b	PAR-CLIP	23592263
MIRT451873	hsa-miR-1287-5p	PAR-CLIP	23592263
MIRT451871	hsa-miR-4434	PAR-CLIP	23592263
MIRT451872	hsa-miR-4516	PAR-CLIP	23592263
MIRT451870	hsa-miR-5703	PAR-CLIP	23592263
MIRT451869	hsa-miR-185-5p	PAR-CLIP	23592263
MIRT451868	hsa-miR-4306	PAR-CLIP	23592263
MIRT451867	hsa-miR-4644	PAR-CLIP	23592263
MIRT451866	hsa-miR-5192	PAR-CLIP	23592263
MIRT451865	hsa-miR-4764-5p	PAR-CLIP	23592263
MIRT451864	hsa-miR-7847-3p	PAR-CLIP	23592263
MIRT451863	hsa-miR-4531	PAR-CLIP	23592263
MIRT451862	hsa-miR-3125	PAR-CLIP	23592263
MIRT451861	hsa-miR-3916	PAR-CLIP	23592263
MIRT451860	hsa-miR-6859-5p	PAR-CLIP	23592263
MIRT451858	hsa-miR-6124	PAR-CLIP	23592263
MIRT451859	hsa-miR-583	PAR-CLIP	23592263
MIRT451857	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT451856	hsa-miR-6826-5p	PAR-CLIP	23592263
MIRT451855	hsa-miR-6731-3p	PAR-CLIP	23592263
MIRT451854	hsa-miR-4738-3p	PAR-CLIP	23592263
MIRT451853	hsa-miR-6749-3p	PAR-CLIP	23592263
MIRT442905	hsa-miR-936	PAR-CLIP	22100165
MIRT442903	hsa-miR-199a-3p	PAR-CLIP	22100165
MIRT442902	hsa-miR-199b-3p	PAR-CLIP	22100165
MIRT442901	hsa-miR-3129-5p	PAR-CLIP	22100165
MIRT442900	hsa-miR-4662a-5p	PAR-CLIP	22100165
MIRT442899	hsa-miR-222-5p	PAR-CLIP	22100165
MIRT1379182	hsa-miR-106a	CLIP-seq
MIRT1379183	hsa-miR-106b	CLIP-seq
MIRT1379184	hsa-miR-1184	CLIP-seq
MIRT1379185	hsa-miR-1200	CLIP-seq
MIRT1379186	hsa-miR-1205	CLIP-seq
MIRT1379187	hsa-miR-1276	CLIP-seq
MIRT1379188	hsa-miR-1284	CLIP-seq
MIRT1379189	hsa-miR-130a	CLIP-seq
MIRT1379190	hsa-miR-130b	CLIP-seq
MIRT1379191	hsa-miR-132	CLIP-seq
MIRT1379192	hsa-miR-17	CLIP-seq
MIRT1379193	hsa-miR-20a	CLIP-seq
MIRT1379194	hsa-miR-20b	CLIP-seq
MIRT1379195	hsa-miR-212	CLIP-seq
MIRT1379196	hsa-miR-2467-3p	CLIP-seq
MIRT1379197	hsa-miR-301a	CLIP-seq
MIRT1379198	hsa-miR-301b	CLIP-seq
MIRT1379199	hsa-miR-3074-5p	CLIP-seq
MIRT1379200	hsa-miR-3124-3p	CLIP-seq
MIRT1379201	hsa-miR-3140-5p	CLIP-seq
MIRT1379202	hsa-miR-3143	CLIP-seq
MIRT1379203	hsa-miR-3158-5p	CLIP-seq
MIRT1379204	hsa-miR-3160-5p	CLIP-seq
MIRT1379205	hsa-miR-34c-3p	CLIP-seq
MIRT1379206	hsa-miR-3666	CLIP-seq
MIRT1379207	hsa-miR-3678-3p	CLIP-seq
MIRT1379208	hsa-miR-4295	CLIP-seq
MIRT1379209	hsa-miR-4310	CLIP-seq
MIRT1379210	hsa-miR-4311	CLIP-seq
MIRT1379211	hsa-miR-4418	CLIP-seq
MIRT1379212	hsa-miR-454	CLIP-seq
MIRT1379213	hsa-miR-4804-3p	CLIP-seq
MIRT1379214	hsa-miR-486-3p	CLIP-seq
MIRT1379215	hsa-miR-509-3-5p	CLIP-seq
MIRT1379216	hsa-miR-509-5p	CLIP-seq
MIRT1379217	hsa-miR-510	CLIP-seq
MIRT1379218	hsa-miR-512-5p	CLIP-seq
MIRT1379219	hsa-miR-519a	CLIP-seq
MIRT1379220	hsa-miR-519b-3p	CLIP-seq
MIRT1379221	hsa-miR-519c-3p	CLIP-seq
MIRT1379222	hsa-miR-519d	CLIP-seq
MIRT1379223	hsa-miR-544	CLIP-seq
MIRT1379224	hsa-miR-548t	CLIP-seq
MIRT1379225	hsa-miR-582-3p	CLIP-seq
MIRT1379226	hsa-miR-889	CLIP-seq
MIRT1379227	hsa-miR-93	CLIP-seq
MIRT1379187	hsa-miR-1276	CLIP-seq
MIRT1379191	hsa-miR-132	CLIP-seq
MIRT1379195	hsa-miR-212	CLIP-seq
MIRT1379202	hsa-miR-3143	CLIP-seq
MIRT1379209	hsa-miR-4310	CLIP-seq
MIRT1379210	hsa-miR-4311	CLIP-seq
MIRT1379213	hsa-miR-4804-3p	CLIP-seq
MIRT1379217	hsa-miR-510	CLIP-seq
MIRT1379218	hsa-miR-512-5p	CLIP-seq
MIRT1379187	hsa-miR-1276	CLIP-seq
MIRT1379191	hsa-miR-132	CLIP-seq
MIRT1379195	hsa-miR-212	CLIP-seq
MIRT1379202	hsa-miR-3143	CLIP-seq
MIRT1379210	hsa-miR-4311	CLIP-seq
MIRT1379213	hsa-miR-4804-3p	CLIP-seq
MIRT1379182	hsa-miR-106a	CLIP-seq
MIRT1379183	hsa-miR-106b	CLIP-seq
MIRT2336338	hsa-miR-1183	CLIP-seq
MIRT1379184	hsa-miR-1184	CLIP-seq
MIRT1379186	hsa-miR-1205	CLIP-seq
MIRT2336339	hsa-miR-1262	CLIP-seq
MIRT1379187	hsa-miR-1276	CLIP-seq
MIRT1379188	hsa-miR-1284	CLIP-seq
MIRT2336340	hsa-miR-1305	CLIP-seq
MIRT1379189	hsa-miR-130a	CLIP-seq
MIRT1379190	hsa-miR-130b	CLIP-seq
MIRT1379191	hsa-miR-132	CLIP-seq
MIRT2336341	hsa-miR-144	CLIP-seq
MIRT1379192	hsa-miR-17	CLIP-seq
MIRT1379193	hsa-miR-20a	CLIP-seq
MIRT1379194	hsa-miR-20b	CLIP-seq
MIRT1379195	hsa-miR-212	CLIP-seq
MIRT2336342	hsa-miR-217	CLIP-seq
MIRT2336343	hsa-miR-221	CLIP-seq
MIRT2336344	hsa-miR-222	CLIP-seq
MIRT2336345	hsa-miR-2278	CLIP-seq
MIRT1379196	hsa-miR-2467-3p	CLIP-seq
MIRT1379197	hsa-miR-301a	CLIP-seq
MIRT1379198	hsa-miR-301b	CLIP-seq
MIRT1379202	hsa-miR-3143	CLIP-seq
MIRT1379203	hsa-miR-3158-5p	CLIP-seq
MIRT2336346	hsa-miR-330-3p	CLIP-seq
MIRT2336347	hsa-miR-338-5p	CLIP-seq
MIRT2336348	hsa-miR-34b	CLIP-seq
MIRT1379205	hsa-miR-34c-3p	CLIP-seq
MIRT2336349	hsa-miR-3614-5p	CLIP-seq
MIRT1379206	hsa-miR-3666	CLIP-seq
MIRT1379207	hsa-miR-3678-3p	CLIP-seq
MIRT2336350	hsa-miR-377	CLIP-seq
MIRT2336351	hsa-miR-3913-3p	CLIP-seq
MIRT2336352	hsa-miR-4279	CLIP-seq
MIRT1379208	hsa-miR-4295	CLIP-seq
MIRT1379209	hsa-miR-4310	CLIP-seq
MIRT1379210	hsa-miR-4311	CLIP-seq
MIRT1379211	hsa-miR-4418	CLIP-seq
MIRT2336353	hsa-miR-4422	CLIP-seq
MIRT2336354	hsa-miR-450b-5p	CLIP-seq
MIRT1379212	hsa-miR-454	CLIP-seq
MIRT2336355	hsa-miR-4693-5p	CLIP-seq
MIRT2336356	hsa-miR-4699-3p	CLIP-seq
MIRT2336357	hsa-miR-4701-3p	CLIP-seq
MIRT2336358	hsa-miR-4705	CLIP-seq
MIRT2336359	hsa-miR-4742-3p	CLIP-seq
MIRT2336360	hsa-miR-4778-5p	CLIP-seq
MIRT1379213	hsa-miR-4804-3p	CLIP-seq
MIRT2336361	hsa-miR-489	CLIP-seq
MIRT2336362	hsa-miR-495	CLIP-seq
MIRT1379215	hsa-miR-509-3-5p	CLIP-seq
MIRT1379216	hsa-miR-509-5p	CLIP-seq
MIRT1379217	hsa-miR-510	CLIP-seq
MIRT1379218	hsa-miR-512-5p	CLIP-seq
MIRT1379219	hsa-miR-519a	CLIP-seq
MIRT1379220	hsa-miR-519b-3p	CLIP-seq
MIRT1379221	hsa-miR-519c-3p	CLIP-seq
MIRT1379222	hsa-miR-519d	CLIP-seq
MIRT1379223	hsa-miR-544	CLIP-seq
MIRT2336363	hsa-miR-548ac	CLIP-seq
MIRT2336364	hsa-miR-548ae	CLIP-seq
MIRT2336365	hsa-miR-548aj	CLIP-seq
MIRT2336366	hsa-miR-548am	CLIP-seq
MIRT2336367	hsa-miR-548d-3p	CLIP-seq
MIRT1379224	hsa-miR-548t	CLIP-seq
MIRT2336368	hsa-miR-548v	CLIP-seq
MIRT2336369	hsa-miR-548x	CLIP-seq
MIRT2336370	hsa-miR-548z	CLIP-seq
MIRT2336371	hsa-miR-630	CLIP-seq
MIRT2336372	hsa-miR-646	CLIP-seq
MIRT1379227	hsa-miR-93	CLIP-seq
MIRT1379187	hsa-miR-1276	CLIP-seq
MIRT1379188	hsa-miR-1284	CLIP-seq
MIRT1379191	hsa-miR-132	CLIP-seq
MIRT1379195	hsa-miR-212	CLIP-seq
MIRT1379196	hsa-miR-2467-3p	CLIP-seq
MIRT1379202	hsa-miR-3143	CLIP-seq
MIRT1379203	hsa-miR-3158-5p	CLIP-seq
MIRT1379205	hsa-miR-34c-3p	CLIP-seq
MIRT1379207	hsa-miR-3678-3p	CLIP-seq
MIRT1379209	hsa-miR-4310	CLIP-seq
MIRT1379210	hsa-miR-4311	CLIP-seq
MIRT1379211	hsa-miR-4418	CLIP-seq
MIRT1379213	hsa-miR-4804-3p	CLIP-seq
MIRT1379215	hsa-miR-509-3-5p	CLIP-seq
MIRT1379216	hsa-miR-509-5p	CLIP-seq
MIRT1379217	hsa-miR-510	CLIP-seq
MIRT1379218	hsa-miR-512-5p	CLIP-seq
MIRT2336338	hsa-miR-1183	CLIP-seq
MIRT1379184	hsa-miR-1184	CLIP-seq
MIRT1379186	hsa-miR-1205	CLIP-seq
MIRT1379187	hsa-miR-1276	CLIP-seq
MIRT1379188	hsa-miR-1284	CLIP-seq
MIRT1379191	hsa-miR-132	CLIP-seq
MIRT1379195	hsa-miR-212	CLIP-seq
MIRT2336343	hsa-miR-221	CLIP-seq
MIRT2336344	hsa-miR-222	CLIP-seq
MIRT2336345	hsa-miR-2278	CLIP-seq
MIRT1379202	hsa-miR-3143	CLIP-seq
MIRT1379203	hsa-miR-3158-5p	CLIP-seq
MIRT2336347	hsa-miR-338-5p	CLIP-seq
MIRT1379209	hsa-miR-4310	CLIP-seq
MIRT1379210	hsa-miR-4311	CLIP-seq
MIRT2336355	hsa-miR-4693-5p	CLIP-seq
MIRT2336359	hsa-miR-4742-3p	CLIP-seq
MIRT2336360	hsa-miR-4778-5p	CLIP-seq
MIRT1379213	hsa-miR-4804-3p	CLIP-seq
MIRT1379217	hsa-miR-510	CLIP-seq
MIRT1379218	hsa-miR-512-5p	CLIP-seq
MIRT1379223	hsa-miR-544	CLIP-seq
MIRT2336368	hsa-miR-548v	CLIP-seq
MIRT2336371	hsa-miR-630	CLIP-seq
MIRT2336372	hsa-miR-646	CLIP-seq
MIRT1379188	hsa-miR-1284	CLIP-seq
MIRT1379182	hsa-miR-106a	CLIP-seq
MIRT1379183	hsa-miR-106b	CLIP-seq
MIRT1379188	hsa-miR-1284	CLIP-seq
MIRT1379189	hsa-miR-130a	CLIP-seq
MIRT1379190	hsa-miR-130b	CLIP-seq
MIRT2336341	hsa-miR-144	CLIP-seq
MIRT1379192	hsa-miR-17	CLIP-seq
MIRT2630221	hsa-miR-204	CLIP-seq
MIRT2630222	hsa-miR-2053	CLIP-seq
MIRT2630223	hsa-miR-2054	CLIP-seq
MIRT1379193	hsa-miR-20a	CLIP-seq
MIRT1379194	hsa-miR-20b	CLIP-seq
MIRT2630224	hsa-miR-211	CLIP-seq
MIRT2336343	hsa-miR-221	CLIP-seq
MIRT2336344	hsa-miR-222	CLIP-seq
MIRT1379196	hsa-miR-2467-3p	CLIP-seq
MIRT1379197	hsa-miR-301a	CLIP-seq
MIRT1379198	hsa-miR-301b	CLIP-seq
MIRT2630225	hsa-miR-3153	CLIP-seq
MIRT1379203	hsa-miR-3158-5p	CLIP-seq
MIRT2630226	hsa-miR-3173-5p	CLIP-seq
MIRT2630227	hsa-miR-3185	CLIP-seq
MIRT2630228	hsa-miR-3189-3p	CLIP-seq
MIRT1379205	hsa-miR-34c-3p	CLIP-seq
MIRT1379206	hsa-miR-3666	CLIP-seq
MIRT1379207	hsa-miR-3678-3p	CLIP-seq
MIRT2336351	hsa-miR-3913-3p	CLIP-seq
MIRT2630229	hsa-miR-3921	CLIP-seq
MIRT2336352	hsa-miR-4279	CLIP-seq
MIRT1379208	hsa-miR-4295	CLIP-seq
MIRT1379211	hsa-miR-4418	CLIP-seq
MIRT2336354	hsa-miR-450b-5p	CLIP-seq
MIRT1379212	hsa-miR-454	CLIP-seq
MIRT2630230	hsa-miR-4653-5p	CLIP-seq
MIRT2336358	hsa-miR-4705	CLIP-seq
MIRT2336361	hsa-miR-489	CLIP-seq
MIRT1379215	hsa-miR-509-3-5p	CLIP-seq
MIRT1379216	hsa-miR-509-5p	CLIP-seq
MIRT1379219	hsa-miR-519a	CLIP-seq
MIRT1379220	hsa-miR-519b-3p	CLIP-seq
MIRT1379221	hsa-miR-519c-3p	CLIP-seq
MIRT1379222	hsa-miR-519d	CLIP-seq
MIRT1379224	hsa-miR-548t	CLIP-seq
MIRT2336368	hsa-miR-548v	CLIP-seq
MIRT2630231	hsa-miR-569	CLIP-seq
MIRT1379225	hsa-miR-582-3p	CLIP-seq
MIRT1379226	hsa-miR-889	CLIP-seq
MIRT1379227	hsa-miR-93	CLIP-seq
MIRT1379182	hsa-miR-106a	CLIP-seq
MIRT1379183	hsa-miR-106b	CLIP-seq
MIRT1379189	hsa-miR-130a	CLIP-seq
MIRT1379190	hsa-miR-130b	CLIP-seq
MIRT1379192	hsa-miR-17	CLIP-seq
MIRT2630221	hsa-miR-204	CLIP-seq
MIRT2630222	hsa-miR-2053	CLIP-seq
MIRT2630223	hsa-miR-2054	CLIP-seq
MIRT1379193	hsa-miR-20a	CLIP-seq
MIRT1379194	hsa-miR-20b	CLIP-seq
MIRT2630224	hsa-miR-211	CLIP-seq
MIRT1379196	hsa-miR-2467-3p	CLIP-seq
MIRT1379197	hsa-miR-301a	CLIP-seq
MIRT1379198	hsa-miR-301b	CLIP-seq
MIRT2630225	hsa-miR-3153	CLIP-seq
MIRT1379203	hsa-miR-3158-5p	CLIP-seq
MIRT2630227	hsa-miR-3185	CLIP-seq
MIRT2630228	hsa-miR-3189-3p	CLIP-seq
MIRT1379205	hsa-miR-34c-3p	CLIP-seq
MIRT1379206	hsa-miR-3666	CLIP-seq
MIRT1379207	hsa-miR-3678-3p	CLIP-seq
MIRT2336351	hsa-miR-3913-3p	CLIP-seq
MIRT2630229	hsa-miR-3921	CLIP-seq
MIRT1379208	hsa-miR-4295	CLIP-seq
MIRT1379211	hsa-miR-4418	CLIP-seq
MIRT1379212	hsa-miR-454	CLIP-seq
MIRT2630230	hsa-miR-4653-5p	CLIP-seq
MIRT2336361	hsa-miR-489	CLIP-seq
MIRT1379215	hsa-miR-509-3-5p	CLIP-seq
MIRT1379216	hsa-miR-509-5p	CLIP-seq
MIRT1379219	hsa-miR-519a	CLIP-seq
MIRT1379220	hsa-miR-519b-3p	CLIP-seq
MIRT1379221	hsa-miR-519c-3p	CLIP-seq
MIRT1379222	hsa-miR-519d	CLIP-seq
MIRT1379224	hsa-miR-548t	CLIP-seq
MIRT2630231	hsa-miR-569	CLIP-seq
MIRT1379226	hsa-miR-889	CLIP-seq
MIRT1379227	hsa-miR-93	CLIP-seq

Show/Hide all (14)

Transcription factor	Regulation	Reference
DDB2	Repression	18431487
FOXO4	Activation	21536589
JUN	Unknown	15330761
NFE2L2	Activation	22493435
NFKB1	Activation	11880364;14515147;19507253
NFKB1	Unknown	15330761;18779124
PPARA	Unknown	19958503
REL	Activation	11880364
RELA	Activation	11880364;14515147;19507253
RELA	Unknown	15330761;18779124
SP1	Repression	11853549
SP1	Unknown	18779124;23500038
TFAP2A	Unknown	23500038
XBP1	Unknown	17192397

101

Show/Hide all (101)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000302	Process	Response to reactive oxygen species	IEA
GO:0000303	Process	Response to superoxide	IEA
GO:0000303	Process	Response to superoxide	IMP	16179351
GO:0001666	Process	Response to hypoxia	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	ISS
GO:0001889	Process	Liver development	IEA
GO:0003032	Process	Detection of oxygen	IEA
GO:0003069	Process	Acetylcholine-mediated vasodilation involved in regulation of systemic arterial blood pressure	IEA
GO:0003069	Process	Acetylcholine-mediated vasodilation involved in regulation of systemic arterial blood pressure	ISS
GO:0003677	Function	DNA binding	IEA
GO:0004784	Function	Superoxide dismutase activity	IBA
GO:0004784	Function	Superoxide dismutase activity	IDA	12551919, 14980699, 19265433
GO:0004784	Function	Superoxide dismutase activity	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IBA
GO:0005739	Component	Mitochondrion	IDA	12551919
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	23168492
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005759	Component	Mitochondrial matrix	TAS	10511315
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	9393747
GO:0006749	Process	Glutathione metabolic process	IEA
GO:0006801	Process	Superoxide metabolic process	IDA	12551919, 14980699
GO:0006801	Process	Superoxide metabolic process	IEA
GO:0006801	Process	Superoxide metabolic process	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0006979	Process	Response to oxidative stress	IEA
GO:0007005	Process	Mitochondrion organization	IEA
GO:0007507	Process	Heart development	IEA
GO:0007626	Process	Locomotory behavior	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0008217	Process	Regulation of blood pressure	ISS
GO:0008285	Process	Negative regulation of cell population proliferation	IMP	16179351
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0008631	Process	Intrinsic apoptotic signaling pathway in response to oxidative stress	IEA
GO:0008637	Process	Apoptotic mitochondrial changes	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009791	Process	Post-embryonic development	IEA
GO:0010042	Process	Response to manganese ion	IEA
GO:0010043	Process	Response to zinc ion	IEA
GO:0010269	Process	Response to selenium ion	IEA
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010729	Process	Positive regulation of hydrogen peroxide biosynthetic process	IEA
GO:0014823	Process	Response to activity	IEA
GO:0014823	Process	Response to activity	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019430	Process	Removal of superoxide radicals	IEA
GO:0019430	Process	Removal of superoxide radicals	IEA
GO:0019430	Process	Removal of superoxide radicals	IMP	16179351
GO:0019825	Function	Oxygen binding	IEA
GO:0019899	Function	Enzyme binding	IEA
GO:0022904	Process	Respiratory electron transport chain	IEA
GO:0030097	Process	Hemopoiesis	IEA
GO:0030145	Function	Manganese ion binding	IBA
GO:0030145	Function	Manganese ion binding	IDA	19265433
GO:0030145	Function	Manganese ion binding	IEA
GO:0030145	Function	Manganese ion binding	TAS	10511315
GO:0030335	Process	Positive regulation of cell migration	IMP	20489163
GO:0031667	Process	Response to nutrient levels	IEA
GO:0032364	Process	Intracellular oxygen homeostasis	IMP	16179351
GO:0032496	Process	Response to lipopolysaccharide	IEA
GO:0033591	Process	Response to L-ascorbic acid	IEA
GO:0034021	Process	Response to silicon dioxide	IEA
GO:0034599	Process	Cellular response to oxidative stress	IMP	14980699
GO:0035900	Process	Response to isolation stress	IEA
GO:0035902	Process	Response to immobilization stress	IEA
GO:0042311	Process	Vasodilation	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042554	Process	Superoxide anion generation	IEA
GO:0042645	Component	Mitochondrial nucleoid	IEA
GO:0042743	Process	Hydrogen peroxide metabolic process	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	19822147, 21988832
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IGI	17251466
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0046686	Process	Response to cadmium ion	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048147	Process	Negative regulation of fibroblast proliferation	IEA
GO:0048666	Process	Neuron development	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0048773	Process	Erythrophore differentiation	IEA
GO:0050665	Process	Hydrogen peroxide biosynthetic process	IEA
GO:0051289	Process	Protein homotetramerization	IPI	19265433
GO:0051602	Process	Response to electrical stimulus	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IEA
GO:0055093	Process	Response to hyperoxia	IEA
GO:0060586	Process	Multicellular organismal-level iron ion homeostasis	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071000	Process	Response to magnetism	IEA
GO:0071361	Process	Cellular response to ethanol	IEA
GO:1902176	Process	Negative regulation of oxidative stress-induced intrinsic apoptotic signaling pathway	IMP	12551919
GO:1902631	Process	Negative regulation of membrane hyperpolarization	IEA
GO:1904706	Process	Negative regulation of vascular associated smooth muscle cell proliferation	IDA	27021683
GO:1905461	Process	Positive regulation of vascular associated smooth muscle cell apoptotic process	IDA	27021683
GO:1905932	Process	Positive regulation of vascular associated smooth muscle cell differentiation involved in phenotypic switching	IDA	27021683

MIM	HGNC	e!Ensembl
147460	11180	ENSG00000291237

P04179

Protein name

Superoxide dismutase [Mn], mitochondrial (EC 1.15.1.1)

Protein function

Destroys superoxide anion radicals which are normally produced within the cells and which are toxic to biological systems.

PDB

1AP5 , 1AP6 , 1EM1 , 1JA8 , 1LUV , 1LUW , 1MSD , 1N0J , 1N0N , 1PL4 , 1PM9 , 1QNM , 1SZX , 1VAR , 1XDC , 1XIL , 1ZSP , 1ZTE , 1ZUQ , 2ADP , 2ADQ , 2GDS , 2P4K , 2QKA , 2QKC , 3C3S , 3C3T , 5GXO , 5T30 , 5VF9 , 7KKS , 7KKU , 7KKW , 7KLB , 8SKS , 8VHW , 8VHY , 8VJ0 , 8VJ4 , 8VJ5 , 8VJ8 , 9BVY , 9BW2 , 9BWM , 9BWQ , 9BWR

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00081	Sod_Fe_N	25 → 106	Iron/manganese superoxide dismutases, alpha-hairpin domain	Domain
PF02777	Sod_Fe_C	113 → 216	Iron/manganese superoxide dismutases, C-terminal domain	Domain

Sequence

MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFNKERGHLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVTERYMACKK

Sequence length

222

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway Peroxisome Longevity regulating pathway Longevity regulating pathway - multiple species Huntington disease Chemical carcinogenesis - reactive oxygen species Lipid and atherosclerosis		Transcriptional activation of mitochondrial biogenesis Detoxification of Reactive Oxygen Species Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation FOXO-mediated transcription of oxidative stress, metabolic and neuronal genes

157

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (157)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANEMIA, SIDEROBLASTIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANKYLOSING SPONDYLITIS AND OTHER INFLAMMATORY SPONDYLOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC ANEURYSM, ABDOMINAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ARTHRITIS, RHEUMATOID	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASPHYXIA NEONATORUM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATHEROSCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATROPHIC MACULAR DEGENERATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONNEVIE-ULLRICH SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN INJURIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, DUCTAL, BREAST	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, NON-SMALL-CELL LUNG	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, RENAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMEGALY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY, DILATED	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAROTID ARTERY DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT AND CARDIOMYOPATHY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC PROGRESSIVE EXTERNAL OPHTHALMOPLEGIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ANOMALY OF SKIN	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES, GESTATIONAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC ANGIOPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC PERIPHERAL ANGIOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DILATED CARDIOMYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENTEROCOLITIS, NECROTIZING	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL STENOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL ULCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXTRINSIC ALLERGIC ALVEOLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EXUDATIVE AGE-RELATED MACULAR DEGENERATION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GESTATIONAL DIABETES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERBILIRUBINEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERBILIRUBINEMIA, HEREDITARY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTHYROIDISM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGLYCEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOXIA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFERTILITY, MALE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, ALCOHOLIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG DISEASES, INTERSTITIAL	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUPUS ERYTHEMATOSUS, SYSTEMIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHATIC METASTASIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LYMPHOMA, LARGE B-CELL, DIFFUSE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALE INFERTILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MARFAN SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELAS SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MESOTHELIOMA, MALIGNANT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METHYLMALONIC ACIDEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METHYLMALONIC ACIDURIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Microvascular complications of diabetes, susceptibility to, 6	Conflicting classifications of pathogenicity; risk factor; Uncertain significance	ClinVar CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
MITOCHONDRIAL DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOUTH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS, INCLUSION BODY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROSIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NECROTIZING ENTEROCOLITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEPHROTIC SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURONAL CEROID-LIPOFUSCINOSES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-NEOPLASTIC PERIPHERAL NERVOUS SYSTEM DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC ATROPHY, HEREDITARY, LEBER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPTIC NEURITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOPOROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAPILLOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NERVOUS SYSTEM DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYNEUROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY CARDIOMYOPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY HYPERTHYROIDISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY OPEN ANGLE GLAUCOMA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSES, SUBSTANCE-INDUCED	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SIDEROBLASTIC ANEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN ABNORMALITIES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SOD2 POLYMORPHISM	Conflicting classifications of pathogenicity; risk factor	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID CARCINOMA, ANAPLASTIC	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TONGUE NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRANSIENT ISCHEMIC ATTACK	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TURNER SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UVEITIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VASCULAR DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENTRICULAR DYSFUNCTION, LEFT	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (753)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Abnormal involuntary movement	Abnormal Involuntary Movement	BEFREE	18790709		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	18682580		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acromegaly	Acromegaly	Pubtator	29046499	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Confusional Senile Dementia	Senile Dementia	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	CTD_human_DG	21751358		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Kidney Tubular Necrosis	Renal tubular necrosis	CTD_human_DG	19917352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	27019981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12032830, 18582155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	12907644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	15534883, 21725155, 24677319, 29693699, 29774090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	18930810, 23784082, 28801561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	CTD_human_DG	19381893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	18582155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	12907644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	12907644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	12907644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	23290999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	CTD_human_DG	12907644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Cancer	Adrenal Cancer	BEFREE	30165401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	CTD_human_DG	16319717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	22218650, 26937962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenomyeloneuropathy	Adrenomyeloneuropathy	CTD_human_DG	16319717		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	27019981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	LHGDN	18573360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	19753309, 20206286, 20357718, 24497574, 28202390, 30265681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17376152, 25542503, 26696693, 26881032, 32711556, 32925069, 34857756, 7856748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	25542503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease, Focal Onset	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	16319316, 28476949, 30746607, 30958347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	Pubtator	32711556	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	14568347, 17394531, 17542619, 18759352, 8940623		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	35627142	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	CTD_human_DG	8866423		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	7719145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis With Dementia	Amyotrophic Lateral Sclerosis With Dementia	CTD_human_DG	8866423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	7719145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Guam Form	Amyotrophic lateral sclerosis	CTD_human_DG	8866423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	15829169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	29862858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	10853026, 11053990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	CTD_human_DG	15887859		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16910769		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia	Anemia	CTD_human_DG	20800516		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anemia Sickle Cell	Sickle cell anemia	Pubtator	21574139, 34958669, 35274104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	21574139, 31098737, 31506286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	20206073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Angle Closure Glaucoma	Angle Closure Glaucoma	BEFREE	24070129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	12880680		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anterior uveitis	Uveitis	BEFREE	19628738		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anthracosis	Anthracosis	BEFREE	11977425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm Abdominal	Aortic aneurysm	Pubtator	34777635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	CTD_human_DG	17196988		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	30188935		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Diseases	Aortic Diseases	CTD_human_DG	25101153		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	27325180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aphakia, congenital primary	Congenital primary aphakia	BEFREE	21741706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19696404, 23480168, 29079564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	29470693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	15266664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Reactive	Reactive arthritis	Pubtator	32934294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	19242068, 22006448, 9122163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	15266664		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	BEFREE	18420450, 23984360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asbestosis	Asbestosis	Pubtator	19636420, 23984360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asphyxia Neonatorum	Postnatal asphyxia	CTD_human_DG	17963755		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	14760150, 15589819, 16423340, 16630148, 21703343		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	Pubtator	15743779, 18048809, 22610343, 25931357, 28208751	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Astrocytoma	Astrocytoma	Pubtator	12744469	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	29862858		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	25882094	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	CTD_human_DG	12677255, 20720404		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	BEFREE	19696404, 23480168, 29079564		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atherosclerosis	Atherosclerosis	Pubtator	8644718	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial fibrillation	Pubtator	33747117	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	23588476	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	23333625	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	31018497, 37673435	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	24155217, 29782990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	19195803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	CTD_human_DG	21850155		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	16543247, 31652453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	15884106	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	20056743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	15088300		★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet disease	Pubtator	39317938	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	CTD_human_DG	11165872, 11278550, 11853549, 12032862, 17632733, 19676086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	CTD_human_DG	21749277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid aortic valve	Bicuspid aortic valve	BEFREE	28185644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	28185644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	20712757, 22001364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	20712757, 22001364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	23785434, 34387669, 36476443	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	16626843, 23725507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	CTD_human_DG	14729580, 18930813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	17496311, 18930813, 20441054, 21904836, 23259779, 24035474, 24037914, 24722645, 28179340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	35361071	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	2366819		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	22740707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bonnevie-Ullrich Syndrome	Turner syndrome	CTD_human_DG	25101153		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Ischemia	Cerebral Ischemia	CTD_human_DG	15060315, 17901229, 19429140		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	LHGDN	18682580		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	18682580, 35796015, 8980385	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	CTD_human_DG	21749277		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Stem Ischemia, Transient	Cerebral Ischemia	CTD_human_DG	11333366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	CTD_human_DG	21749277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10328827, 11165872, 11323405, 12063011, 12888106, 14744747, 15168344, 15184255, 15217492, 15386537, 15535847, 15705913, 15883815, 16945136, 16969494 View all (32 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	17965603, 19385967, 19756960, 20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	26678158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11929863, 15217492, 15535847, 15883815, 16080463, 16571274, 16684880, 16859522, 16945136, 18553161, 18845242, 19339246, 19509150, 19563893, 20309628 View all (20 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	17965603, 24448804	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	28368421	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	18553161	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchial Hyperreactivity	Bronchial Hyperreactivity	BEFREE	19213780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	22958044, 8825796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	18824496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10363564, 1306294, 15883815, 18827816, 20233853, 21725155, 37660159	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	10853026, 11053990		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	26847304, 27181103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	27057281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	21527182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	25894370, 27158203, 27221200	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	29774090		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	21527182	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	17496311, 18930813, 20441054, 21904836, 23259779, 24035474, 24037914, 24219772, 24722645, 24919441, 28179340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of Endocrine Gland	Endocrine Gland cancer	BEFREE	30165401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	24074040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	12711112, 15284179, 15534883, 17409931, 17496311, 17548672, 18258609, 18420450, 18930810, 19167605, 22144047, 22987024, 23784082, 23928928, 23990443 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28884887	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25315187, 25755722, 27157976, 28165386, 29914010, 33092599, 33953831, 34528699	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	15298726, 28099906, 30896828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20690800	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	27057281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	12907644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	12907644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17936883, 18834346, 27131313, 27931283, 28884887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	10853026, 11053990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	15591282, 28629836, 28700033, 30044789, 31494578		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	LHGDN	15591282		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	Pubtator	15591282, 35274104, 37872948	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies	Cardiomyopathy	CTD_human_DG	23536361		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathies, Primary	Cardiomyopathy	BEFREE	10425186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies, Primary	Cardiomyopathy	CTD_human_DG	23536361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33303703	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	31037987	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Dilated	Cardiomyopathy	CTD_human_DG	16155095, 21195081		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Dilated	Cardiomyopathy	BEFREE	31494578		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	10425186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	CTD_human_DG	16155095, 21195081		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	17331249, 36012132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	19834686, 21035442, 23480168, 30866842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	12732398, 22330623		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Circulation Transient Ischemic Attack	Transient Ischemic Attack	CTD_human_DG	11333366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	29339024	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	23289810, 8755643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	23970468	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	8755643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract and cardiomyopathy	Sengers syndrome	CTD_human_DG	23266196		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cerebral Palsy	Cerebral palsy	BEFREE	27302388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	20157789, 23727323, 28552711, 8594209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular disorder	Pubtator	34958669	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular Trauma	Cerebrovascular trauma	Pubtator	34790286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	27019981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	26400460		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28356940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangitis Sclerosing	Sclerosing cholangitis	Pubtator	29180269	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	30462567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	26881045, 27630759, 31340563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	18413200, 21045076, 26881045, 27630759, 31530994, 31688999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Insufficiency	Renal Insufficiency	BEFREE	18413200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29031050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	30570876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	16467073, 19213780, 20802415, 28557543, 29804489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	17567676		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	21975116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	Pubtator	21975116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic progressive external ophthalmoplegia	Progressive External Ophthalmoplegia	BEFREE	11403514, 14680979		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic progressive external ophthalmoplegia	Progressive External Ophthalmoplegia	CTD_human_DG	11907800, 14680979		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	27515707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	12447859, 20673159, 21907168, 26873981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	CTD_human_DG	19293248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	29935195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	CTD_human_DG	20446108		★★★★★ ★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	CTD_human_DG	10942521		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	30009828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	23588476, 34857756	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	26696693, 26881032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28401939		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	24483941, 39510220	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Collecting Duct Carcinoma of the Kidney	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	25866291, 29323702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17459574		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	25279216		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	CTD_human_DG	10853026, 12907644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11836586, 15817612, 17632733, 20378690, 20714737, 26674755, 27999194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10363564, 10970696, 16107721, 26674755, 26846100, 33666342, 35883447, 36299603	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	CTD_human_DG	10853026, 12907644		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	11836586		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Common Migraine	Common Migraine	BEFREE	25295643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Complex partial seizures	Seizure	CTD_human_DG	20446108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28356940		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital disorder of glycosylation type II	Congenital disorder of glycosylation	Pubtator	29453449	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	24811984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	CTD_human_DG	16105639, 16155095, 20304815, 21195081, 21284947		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congestive heart failure	Congestive Heart Failure	BEFREE	23480168, 24486397, 27647766, 29116107, 30462567, 30498227, 31494578		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Conotruncal cardiac defects	Conotruncal cardiac defect	Pubtator	24585533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23611775, 29914010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Avellino type	Corneal dystrophy	Pubtator	19497990	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20728955, 21104149, 22170599, 27067415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19696404, 20728955, 22170599, 22738689, 27067415, 31156338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	20009389, 22738689, 30225256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	27067415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	20728955, 22170599, 27067415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Thrombosis	Coronary Thrombosis	BEFREE	29444200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crescendo Transient Ischemic Attacks	Transient Ischemic Attack	CTD_human_DG	11333366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	28052094		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	28052094, 33882797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31535400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	21931865	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	10942521, 12709579, 15964507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	10942521, 12709579, 15964507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	CTD_human_DG	15292528, 18784066, 22108257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20511611, 22108257, 23138846, 28237856, 29339024, 30176344, 30811038, 31784401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	17512466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	22218650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	40142243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	22244747		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	23725507, 23785434, 25295643	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	25171019, 29331597		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	23725507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	29321372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	15128298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	16324912, 17142144, 20097730, 25858271, 25933618, 26439801, 26881045, 29859283, 31146169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	34190178	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	16324912, 17142144, 20097730, 20728955, 25858271, 25933618, 26439801, 26881045, 27925431, 29137485, 29859283, 31146169		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	16475114, 18423055, 20097730, 22688013, 26881045, 27411103, 30037352, 36010644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	LHGDN	18423055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	21975116, 24732311	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	37698290	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	19752172, 24732311, 24819633	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18057537, 22740707, 27258818, 30803440, 32925069, 33426802, 33761612, 37698290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	23685312	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	LHGDN	12540612		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	12606529, 19752172, 19834686, 24819633, 25858271, 29859283, 30736780, 7915978		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	15531508		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16324912, 17142144, 17825092, 18057537, 21035442, 21060152, 21756849, 23685312, 24119114, 24685594, 25283363, 25933618, 26345792, 28871240, 29971528, 31108940 View all (1 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	15983321		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Angiopathies	Diabetic angiopathies	Pubtator	30217947	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	24819633, 37698290	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	17192491		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	19752172, 19834686, 24819633, 28595780, 30876865, 31409386		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	CTD_human_DG	24819633		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Neuropathies	Diabetic Nephropathy	BEFREE	25933618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Polyneuropathies	Diabetic polyneuropathy	BEFREE	14704872		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	17142144, 18057537, 19628492, 19752172, 23221071, 28124145, 29104476, 30190170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	LHGDN	18057537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	18057537, 19752172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12580960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	CTD_human_DG	16081686		★★★★★ ★☆☆☆☆ Found in Text Mining only
Disruptive, Impulse Control, and Conduct Disorders	Impulse control disorder	BEFREE	30813952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	11217146, 12650976, 15670619, 25852816, 2939098		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	7856748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	11592093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren contracture	Pubtator	34270583	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskeratosis Congenita	Dyskeratosis congenita	Pubtator	29055871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	12960753, 20041472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	LHGDN	12960753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	28315561, 36759651	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28552711, 31212050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	27487831	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Electron Transport Chain Deficiencies, Mitochondrial	Mitochondrial Electron Transport Chain Deficiencies	CTD_human_DG	9917329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	29673664, 31795319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	23167810, 30926565, 8372889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	15150448, 22119635, 25372290, 28222320, 31212050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	32219137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epileptic drop attack	Hypotonic seizures	CTD_human_DG	20446108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	18834346, 27131313, 27931283, 28884887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erysipelas	Erysipelas	BEFREE	28512644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	18167182, 21143698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	11053990, 15986332		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	18167182, 21143698		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	18167182		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	22994704, 25659582	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	15986332, 21517111	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Stenosis	Esophageal Stenosis	CTD_human_DG	11121210		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Stricture	Esophageal Stricture	BEFREE	11121210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Stricture	Esophageal Stricture	CTD_human_DG	11121210		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esophagitis	BEFREE	11121210		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophagitis	Esophagitis	CTD_human_DG	11121210		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Hypertension	Hypertension	BEFREE	21053180, 28684630		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	21053180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ethylmalonic encephalopathy	Ethylmalonic Encephalopathy	BEFREE	21410200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exfoliation Syndrome	Exfoliation Syndrome	BEFREE	17453961, 23805041		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	BEFREE	19753309		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fabry Disease	Fabry disease	BEFREE	27938475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	27938475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Intestinal Polyposis	Multiple polyposis syndrome	CTD_human_DG	12907644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	20012093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	2366819, 31553975		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	2366819, 31553975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Farber Lipogranulomatosis	Farber disease	BEFREE	10428046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Farber Lipogranulomatosis	Farber disease	CTD_human_DG	10428046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	24054763	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	CTD_human_DG	10860543		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	24161595, 24649902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	24882572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	30165401		★★★★★ ★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	20383327, 31553975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	19018247		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric ulcer	Gastric ulcer	BEFREE	20872977		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	BEFREE	17466292		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	CTD_human_DG	20446108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	BEFREE	24667176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	25417767, 30811524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	23638916, 25417767		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	11207049, 21649900, 36838582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26616112, 28676971, 28822335, 29862858, 31629402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26616112, 28676971, 28822335, 31629402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10641728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23259684, 28567457, 36809279	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	20150532	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	29693450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen storage disease type II	Glycogen Storage Disease	BEFREE	19753309, 20206286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gonadal Dysgenesis, 45,X	Gonadal Dysgenesis	CTD_human_DG	25101153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	22065933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	16107721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	15369176, 29974842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	34479919, 34681918, 37108069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Disorders	Headache	Pubtator	26400460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	20534900, 22877234, 25484013, 26400460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	38098073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	24811984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	15591282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	23904881	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	CTD_human_DG	16105639, 16155095, 20304815, 21195081, 21284947		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	24486397, 27647766, 29116107, 30498227, 31494578		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Failure, Right-Sided	Heart Failure	CTD_human_DG	16105639, 16155095, 20304815, 21195081, 21284947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	BEFREE	15591282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemolysis	Hemolysis	Pubtator	35274104	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	23857333	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	9626579	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C Chronic	Hepatitis c	Pubtator	9626579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular degeneration	Pubtator	19571474	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	BEFREE	24517502		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	15883815	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	10853026, 14503839, 19424620, 25279216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	30120672, 30897183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	30120672	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	20206286, 26882122, 28552711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	12606529, 23221071, 26439801, 29477910, 30359759, 30662833, 31685635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	24093550	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	17043800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia Familial Combined	Hyperlipidemia	Pubtator	9683614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	15286004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17331249	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	11834524, 21593737, 25101153		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	21053180, 23111423, 28684630, 30717220, 31189433		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	CTD_human_DG	19914224		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoglycemia	Hypoglycemia	CTD_human_DG	20620209		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypothyroidism	Hypothyroidism	BEFREE	30736780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	Pubtator	30736780	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20110409, 35301432	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	23958427, 24267255	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	24275138, 30137220, 33174051	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	27302388		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Membranous Glomerulonephritis	Membranous Glomerulonephritis	BEFREE	30783455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	9152291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	20529999, 27021683, 27246590, 27343087, 28272301, 29903860, 31429204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	31119153	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	40294812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29765980, 30866842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infarction, Middle Cerebral Artery	Cerebral Infraction	CTD_human_DG	21940958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Female	Female infertility	Pubtator	28040123	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	36592993	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	29180269	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	32410873, 9122163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	29321372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Insomnia Fatal Familial	Insomnia	Pubtator	27338255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	25372290		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	25372290	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28430387, 31773668		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	35409356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	CTD_human_DG	23964924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	26543228		★★★★★ ★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG	20471444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG	20471444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	15591282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	LHGDN	15591282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron overload	Pubtator	15591282	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28198160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic Stroke	Ischemic stroke	Pubtator	34790286	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Jacksonian Seizure	Jacksonian Seizure	CTD_human_DG	20446108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kearns-Sayre syndrome	Kearns Sayre Syndrome	BEFREE	8836981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	31576926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	12606529, 24819633, 25858271, 29416622		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	CTD_human_DG	19917352, 21571061		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney disease	Pubtator	24819633	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure Chronic	Kidney failure	Pubtator	26881045, 31340563, 31382611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	26881045	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29563990, 30502252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	26881045, 31340563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	25279216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	28165386	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Left-Sided Heart Failure	Heart Failure	CTD_human_DG	16105639, 16155095, 20304815, 21195081, 21284947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh Syndrome	BEFREE	29453449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	29453449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	27132285		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	17496311		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	17496311, 8353281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	8353281	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	10759716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29127121		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	23063716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	CTD_human_DG	16141792		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy Body Disease	BEFREE	26667592		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	9095410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	16767786, 18760346, 19731237, 21472284		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19731237, 19929244, 20673159, 21240526, 22656864, 25894370, 27221200, 31041878, 31423616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	12447859, 20673159, 21907168, 26873981		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	19731237, 26873981		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	CTD_human_DG	19731237		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver Diseases Alcoholic	Liver disease	Pubtator	26937962	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	15869407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	19754948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	11849743, 1385428		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	CTD_human_DG	8063194		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases, Interstitial	Lung Diseases	CTD_human_DG	10673208		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	17409931, 18466086, 19167605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	18466086, 20690800, 21705328, 23271813, 30111255, 31205586, 33846781, 36037114, 38013118, 40294812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	22064654, 25866291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	14611903		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	14611903, 18095014		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic Metastasis	CTD_human_DG	10853026, 19381893, 20618948		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	18460737, 20618948, 21319141, 22517484, 40244057	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24569473	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphoma	Lymphoma	BEFREE	16956821, 29031050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	17149600, 22522002		★★★★★ ★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	21536589		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	19753309, 24497574, 24667176, 27998274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular dystrophy, corneal type 1	Macular corneal dystrophy	BEFREE	28649515		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16626843, 23725507, 24967945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	CTD_human_DG	20471444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	25295643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	15369176, 29974842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	CTD_human_DG	20617513		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	21749277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10328827, 11165872, 11323405, 12063011, 12888106, 14744747, 15184255, 15217492, 15386537, 15535847, 15705913, 15883815, 16945136, 16969494, 17145829 View all (30 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	17965603, 19385967, 19756960, 20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	11053990, 15986332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	18167182, 21143698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	25279216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	29893116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	24074040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	15869407, 31041878		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	12711112, 15284179, 17409931, 17496311, 17548672, 18258609, 18420450, 18930810, 19167605, 22144047, 22525041, 22987024, 23784082, 23928928, 23990443 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	CTD_human_DG	12543247, 15274141		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	9095410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	CTD_human_DG	16179351, 18594523		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17936883, 18834346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	12700280, 15018733, 18205184, 20097730, 20966810, 22547077, 26439801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	CTD_human_DG	17895890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12592389, 15933380, 17465268, 17548672, 17646272, 18582155, 18646267, 18784358, 19074884, 19405048, 19528373, 19647296, 20477822, 21982398, 22564066 View all (10 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	12592389, 17465268, 17646272, 18829485, 19074884, 22564066, 23315858, 26468117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	CTD_human_DG	11507057, 20454814, 22009531, 25362851		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	17186424		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	10853026, 14503839, 19424620, 25279216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	14503839, 20872977, 22517484, 23030347, 30242560, 30536754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	CTD_human_DG	20618948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	CTD_human_DG	14729580, 18930813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	17496311, 18930813, 20441054, 21904836, 23259779, 24035474, 24037914, 24219772, 24722645, 24919441, 28179340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10919671, 11165872, 11849743, 14503839, 15044326, 16910775, 17192397, 18023606, 18553161, 19405048, 20204285, 20454814, 20712406, 21143698, 22946823 View all (22 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CTD_human_DG	11165872, 11278550, 11853549, 12032862, 17632733, 19676086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	25279216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	25866291, 29323702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	17965603, 19385967, 19756960, 20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Ductal Carcinoma	Marfan Syndrome	CTD_human_DG	23964924		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15184255, 15883815, 16933053, 16945136, 16969494, 17473980, 17719580, 17922231, 19064542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	17965603, 19385967, 19756960, 20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19339246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	17965603, 19385967, 19756960, 20562527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan Syndrome	CTD_human_DG	25101153		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Marfan Syndrome, Type I	Marfan Syndrome	CTD_human_DG	25101153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	26400460	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29342889, 8144583, 8464931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29342889	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31535400, 8026882, 8572603, 9095410, 9649709, 9764808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	36631465, 37401304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MELAS Syndrome	MELAS Syndrome	BEFREE	11403514		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELAS Syndrome	MELAS Syndrome	CTD_human_DG	11907800		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MELAS Syndrome	Melas syndrome	Pubtator	34106788	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meniere Disease	Meniere Disease	BEFREE	22877234		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	BEFREE	22972774, 23792044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningomyelocele	Meningomyelocele	CTD_human_DG	22972774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	22244747		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	29331597		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MERRF Syndrome	MERRF Syndrome	BEFREE	11403514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	10737384	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	CTD_human_DG	11283936, 15039138, 17290392, 9533946		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	BEFREE	15039138		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma	Mesothelioma	LHGDN	17290392		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mesothelioma Malignant	Mesothelioma	Pubtator	10737384, 38013118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	26881045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	26881045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	22272346	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	22272346, 31212050		★★★★★ ★☆☆☆☆ Found in Text Mining only
Middle Cerebral Artery Thrombosis	Cerebral Thrombosis	CTD_human_DG	21940958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	25295643, 25818327		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	25295643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	25295643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	25295643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	26696693		★★★★★ ★☆☆☆☆ Found in Text Mining only
MILES-CARPENTER X-LINKED MENTAL RETARDATION SYNDROME	MILES-CARPENTER X-Linked MENTAL RETARDATION SYNDROME	BEFREE	18569577, 23967348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	26821085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial complex I deficiency	Mitochondrial complex deficiency	Pubtator	8755643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial Diseases	BEFREE	11403514		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial disease	Pubtator	17192393, 18678321, 23138846, 28652419, 36737723	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial disease	Pubtator	21175348	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial disease	Pubtator	34958669	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial Diseases	CTD_human_DG	9917329		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Myopathies	Mitochondrial myopathy	Pubtator	17551003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Respiratory Chain Deficiencies	Mitochondrial Respiratory Chain Deficiencies	CTD_human_DG	9917329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	16626843		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood disorder	Pubtator	23725507	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	10529750		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	CTD_human_DG	12543247, 15274141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mouth Neoplasms	Mouth Neoplasms	BEFREE	9095410		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Acyl Coenzyme A Dehydrogenase Deficiency	Multiple Acyl-CoA Dehydrogenase Deficiency	BEFREE	31215835		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	15908783		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	15908783		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	15908783, 22471522, 23063726	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	BEFREE	17192397		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	LHGDN	18930811		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	35732787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	21773993	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelocele	Myelocele	CTD_human_DG	22972774		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	26950655		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29550484		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Diseases, Secondary	Myocardial Diseases	CTD_human_DG	23536361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Failure	Myocardial Infarction	CTD_human_DG	16105639, 16155095, 20304815, 21195081, 21284947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	12160945		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial Infarction	BEFREE	26721595, 30552292		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial Ischemia	BEFREE	21104149		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Ischemia	Myocardial ischemia	Pubtator	28165386	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myofibrillar Myopathy	Myofibrillar myopathy	Pubtator	17784878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	21975116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	20012547, 20204285		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	CTD_human_DG	20461718		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22160175, 36737723	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	12744469	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing Enterocolitis	Necrotizing Enterocolitis	CTD_human_DG	18806098		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	26426434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10463060, 10769628, 10919671, 11121210, 11165872, 11491651, 12592389, 12600239, 1330936, 15534883, 17632733, 18167182, 18829485, 19024650, 19676086 View all (42 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	CTD_human_DG	11165872, 11278550, 11853549, 12032862, 17632733, 19676086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	CTD_human_DG	21749277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	CTD_human_DG	9152291		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic Syndrome, Minimal Change	Nephrotic Syndrome	BEFREE	9152291		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	11403514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural tube defect	Pubtator	34090432	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17394531, 19101687, 24736663, 31228093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	18280257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	23785434	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	10942521, 12709579, 15964507		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23727323		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuronal Ceroid-Lipofuscinoses	Neuronal Ceroid Lipofuscinosis	LHGDN	12946273		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neutropenia	Neutropenia	Pubtator	20309628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nodular glomerulosclerosis	Glomerulosclerosis	CTD_human_DG	24819633		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	21756849, 28552526, 31255630, 31756344, 31786336		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	CTD_human_DG	11731445, 17094902		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15331175, 30279365, 31781331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	24597775, 24649902, 26937962		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	16807759, 19219857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	16317704, 23956348, 30738174		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	19262996, 25958349, 29953407, 31212050		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	Pubtator	21727734, 22688013, 23685312, 26123268, 32709094, 33761612, 35968712, 38127891	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oligospermia	Oligospermia	BEFREE	30116493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy Hereditary Leber	Leber hereditary optic neuropathy	Pubtator	15720387	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	15720387, 17296905		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Optic Neuropathy	Optic Neuropathy	BEFREE	15293270		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	32378537	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	40244057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	18784066, 23138846, 29339024, 38127891	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	22108257	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthrosis Deformans	Osteoarthrosis Deformans	CTD_human_DG	15292528, 18784066, 22108257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	32141579	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	33149812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	Pubtator	18924182, 21773993, 23329517	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis	Osteoporosis	BEFREE	21773993, 22089180, 26336112, 30216504		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoporosis, Age-Related	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Postmenopausal	Osteoporosis	BEFREE	31669348		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis, Senile	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	18834346		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	16179351		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	CTD_human_DG	16179351, 18594523		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	17936883, 18834346		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	1306294, 18594523, 26359457, 30700285, 35594792	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Oxidative Phosphorylation Deficiencies	Oxidative Phosphorylation Deficiency	CTD_human_DG	9917329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	CTD_human_DG	11328670		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	12700280, 15018733, 18205184, 20097730, 20966810, 22547077, 26439801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12700280, 18205184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	CTD_human_DG	17895890		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	15155719, 18205184, 18497575, 19351855, 20097730, 22547077, 28099906	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20097730	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatitis, Chronic	Pancreatitis	BEFREE	28655148		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	30165401		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	CTD_human_DG	11507057		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma	Papilloma	BEFREE	22009531		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma, Squamous Cell	Papilloma	CTD_human_DG	11507057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillomatosis	Papillomatosis	CTD_human_DG	11507057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10049782, 17188257, 20501330, 22723845, 23261939, 25279756, 29068596, 29718367, 31601079, 9371904		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	17188257, 18353766, 25279756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	22723845, 23785434, 28922168, 31601079	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	25279756, 31601079	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	BEFREE	9371904, 9634534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson disease	Pubtator	9042918	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	9371904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal ventricular fibrillation	Paroxysmal ventricular fibrillation	Pubtator	21130430	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	29953407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	26718428		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	31470840	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	21975116, 26718428, 29972711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	21975116, 40294979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	CTD_human_DG	20864405		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Peritonitis	Peritonitis	Pubtator	24204994	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Persistent Fetal Circulation Syndrome	Persistent Fetal Circulation	BEFREE	31476900		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	31422516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	30206965, 30607774, 31781040		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	32289280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	30570876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyposis, Adenomatous Intestinal	Multiple polyposis syndrome	CTD_human_DG	12907644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Osteoporosis	Osteoporosis	CTD_human_DG	18924182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Posterior Circulation Transient Ischemic Attack	Transient Ischemic Attack	CTD_human_DG	11333366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	27019981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	8633092		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	17512466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	CTD_human_DG	19374891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary angle-closure glaucoma	Angle closure glaucoma	BEFREE	24070129		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Hyperthyroidism	Hyperthyroidism	CTD_human_DG	19914224		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Primary malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	21749277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	30259659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary sclerosing cholangitis	Sclerosing Cholangitis	BEFREE	29180269		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12592389, 15933380, 17465268, 17548672, 17646272, 18582155, 18646267, 18784358, 19074884, 19405048, 19528373, 19647296, 20477822, 21982398, 22564066 View all (10 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	12592389, 19074884		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12592389, 15512801, 17465268, 17646272, 18571701, 18784358		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	12592389, 17465268, 17646272, 18829485, 19074884, 22564066, 23315858, 26468117		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15781667, 16261162, 17465268, 17876045, 18296681, 18553161, 18571701, 18784358, 19074884, 19368118, 19528373, 20477822, 21982398, 22564066, 23315858 View all (11 more)	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	24212762		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	CTD_human_DG	7744320		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psychosis, Involutional	Psychosis	CTD_human_DG	20471444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	16807759, 19219857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	20529999, 28272301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	28272301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	15516670	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	17567676, 19213780, 28025995, 34831227, 35609226	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27522058, 29731719		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pustulosis of Palms and Soles	Palmoplantar Pustules	CTD_human_DG	7744320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Radiation Syndrome	Radiation Syndrome	CTD_human_DG	16540396, 21945096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Reactive hypoglycemia	Reactive hypoglycemia	CTD_human_DG	20620209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	20644561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Recurrent Brain Neoplasm	Brain Neoplasms	CTD_human_DG	21749277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	29893116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	11721640		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29914010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	29197622, 29765500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal tubular disorder	Renal Tubular Disorder	BEFREE	28665927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	CTD_human_DG	25070658		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	22958044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	20802415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Reticulosarcoma	Reticulosarcoma	BEFREE	12580960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	25858271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	22958044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10765931, 12590982, 19242068, 30718447		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Rheumatoid Arthritis	Rheumatoid arthritis	CTD_human_DG	12833524, 15292528, 24313545		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	31476900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	CTD_human_DG	10673208		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	LHGDN	15581626		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	15581626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	18987137	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcomatoid Renal Cell Carcinoma	Renal Carcinoma	CTD_human_DG	15108329		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	12960753, 15610954, 17055157, 17291655, 17582511, 18977034, 19778569, 19946932, 20346996, 22001364, 26356721		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	12960753, 15338334		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17582511, 19946932, 20346996, 22001364		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	23588476, 23785434	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	31119153	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seizures	Seizures	Pubtator	32219137	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	23142385, 29540208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shwachman syndrome	Shwachman Syndrome	BEFREE	30938873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sideroblastic anemia	Sideroblastic Anemia	BEFREE	16910769		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sideroblastic anemia	Sideroblastic Anemia	CTD_human_DG	16910769, 21326867		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Single Seizure	Seizure	CTD_human_DG	20446108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	CTD_human_DG	11507057, 20454814, 22009531, 25362851		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Neoplasms	Skin neoplasm	Pubtator	9886257	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	25400754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SPHEROCYTOSIS, TYPE 1 (disorder)	Spherocytosis	BEFREE	30571282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	12543247, 15274141		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	12600239, 16910775, 17186424, 29774090		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	LHGDN	17822322, 18460737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	18167182, 21517111		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	21143698, 23649652, 24626613, 31364751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	18460737, 19487542, 20618948, 21940907, 22580338, 28841898, 28904321, 29802697, 34479919	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17822322, 21940907, 28841898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	20618948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	19487542, 20618948, 22580338, 25552924, 25578561, 27926482, 28978113		★★★★★ ★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	29444200		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	29855848		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	10860543		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	17032401, 17295176, 18445359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	14503839, 20872977, 22517484, 23030347, 30242560, 30536754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	20233853, 30574618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	10853026, 14503839, 19424620, 25279216		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	14503839		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	14503839, 18384434, 18827816, 20233853, 20872977, 21725155, 22517484, 25545243, 25684475, 26646027, 30242560, 30536754	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28053989, 29872034, 30551525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32031754	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	CTD_human_DG	20618948		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tonic - clonic seizures	Seizure	CTD_human_DG	20446108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tooth Diseases	Tooth disease	Pubtator	25619900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	CTD_human_DG	11333366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Cerebral Ischemia	Cerebral Ischemia	BEFREE	28534982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack	Transient Ischemic Attack	CTD_human_DG	11333366		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transient Ischemic Attack	Transient Ischemic Attack	BEFREE	28534982		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Transient Ischemic Attack, Anterior Circulation	Transient Ischemic Attack	CTD_human_DG	11333366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Transient Ischemic Attack, Vertebrobasilar Circulation	Transient Ischemic Attack	CTD_human_DG	11333366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29748761		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31182923, 35017469, 38104484	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Turner Syndrome	Turner Syndrome	CTD_human_DG	25101153		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	19715479, 29401402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	10853026, 11053990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	25402510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18930813, 24219772, 24494199, 24722645, 24919441, 36676755, 37660159	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urolithiasis	Urolithiasis	Pubtator	37878647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urologic Neoplasms	Urologic neoplasm	Pubtator	31929112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urticaria	Urticaria	LHGDN	17171548		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	21725155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21319141, 23886214, 24569473, 26490979	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	CTD_human_DG	19578012, 21850155		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Diseases	Vascular Diseases	BEFREE	15347773, 15983321, 28552711		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular Diseases	Vascular Diseases	CTD_human_DG	18596060		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	21130430		★★★★★ ★☆☆☆☆ Found in Text Mining only
Visual seizure	Seizure	CTD_human_DG	20446108		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	24036105, 27100222		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	24036105, 27100222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitreoretinopathy Proliferative	Vitreoretinopathy	Pubtator	37107562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SOD2 (superoxide dismutase 2)