Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	664
Gene name	BCL2 interacting protein 3
Gene symbol	BNIP3
Synonyms (NCBI Gene)	HABONNIP3
Chromosome	10
Chromosome location	10q26.3
Summary	This gene is encodes a mitochondrial protein that contains a BH3 domain and acts as a pro-apoptotic factor. The encoded protein interacts with anti-apoptotic proteins, including the E1B 19 kDa protein and Bcl2. This gene is silenced in tumors by DNA methy

138

Show/Hide all (138)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000305	hsa-miR-145-5p	Luciferase reporter assayqRT-PCRWestern blot	20332243
MIRT000305	hsa-miR-145-5p	Luciferase reporter assayqRT-PCRWestern blot	20332243
MIRT000305	hsa-miR-145-5p	Luciferase reporter assay	20332243
MIRT004753	hsa-miR-221-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	20018759
MIRT000305	hsa-miR-145-5p	MicroarrayqRT-PCR	22815788
MIRT437693	hsa-miR-27a-3p	MicroarrayqRT-PCR	22815788
MIRT437701	hsa-miR-27b-3p	MicroarrayqRT-PCR	22815788
MIRT437785	hsa-miR-210-3p	Luciferase reporter assayqRT-PCRWestern blot	23688833
MIRT437693	hsa-miR-27a-3p	Luciferase reporter assayWestern blottingImmunoprecipitaion (IP)qRT-PCR	31923741
MIRT437785	hsa-miR-210-3p	MicroarrayqRT-PCR	35816043
MIRT823404	hsa-miR-103a	CLIP-seq
MIRT823405	hsa-miR-107	CLIP-seq
MIRT823406	hsa-miR-1204	CLIP-seq
MIRT823407	hsa-miR-1267	CLIP-seq
MIRT823408	hsa-miR-214	CLIP-seq
MIRT823409	hsa-miR-3610	CLIP-seq
MIRT823410	hsa-miR-3619-5p	CLIP-seq
MIRT823411	hsa-miR-3674	CLIP-seq
MIRT823412	hsa-miR-3914	CLIP-seq
MIRT823413	hsa-miR-4291	CLIP-seq
MIRT823414	hsa-miR-4297	CLIP-seq
MIRT823415	hsa-miR-4310	CLIP-seq
MIRT823416	hsa-miR-4520a-3p	CLIP-seq
MIRT823417	hsa-miR-4520b-3p	CLIP-seq
MIRT823418	hsa-miR-4529-3p	CLIP-seq
MIRT823419	hsa-miR-4652-3p	CLIP-seq
MIRT823420	hsa-miR-4682	CLIP-seq
MIRT823421	hsa-miR-4685-5p	CLIP-seq
MIRT823422	hsa-miR-4701-5p	CLIP-seq
MIRT823423	hsa-miR-548a-3p	CLIP-seq
MIRT823424	hsa-miR-548a-5p	CLIP-seq
MIRT823425	hsa-miR-548ab	CLIP-seq
MIRT823426	hsa-miR-548ak	CLIP-seq
MIRT823427	hsa-miR-548b-5p	CLIP-seq
MIRT823428	hsa-miR-548c-5p	CLIP-seq
MIRT823429	hsa-miR-548d-5p	CLIP-seq
MIRT823430	hsa-miR-548e	CLIP-seq
MIRT823431	hsa-miR-548f	CLIP-seq
MIRT823432	hsa-miR-548h	CLIP-seq
MIRT823433	hsa-miR-548i	CLIP-seq
MIRT823434	hsa-miR-548j	CLIP-seq
MIRT823435	hsa-miR-548k	CLIP-seq
MIRT823436	hsa-miR-548l	CLIP-seq
MIRT823437	hsa-miR-548w	CLIP-seq
MIRT823438	hsa-miR-548y	CLIP-seq
MIRT823439	hsa-miR-559	CLIP-seq
MIRT823440	hsa-miR-562	CLIP-seq
MIRT823441	hsa-miR-588	CLIP-seq
MIRT823442	hsa-miR-761	CLIP-seq
MIRT823443	hsa-miR-922	CLIP-seq
MIRT1545774	hsa-miR-128	CLIP-seq
MIRT1545775	hsa-miR-27a	CLIP-seq
MIRT1545776	hsa-miR-27b	CLIP-seq
MIRT1545777	hsa-miR-3647-3p	CLIP-seq
MIRT1545778	hsa-miR-411	CLIP-seq
MIRT1545779	hsa-miR-4282	CLIP-seq
MIRT1545780	hsa-miR-4699-3p	CLIP-seq
MIRT1545781	hsa-miR-5096	CLIP-seq
MIRT1545782	hsa-miR-513a-5p	CLIP-seq
MIRT1545783	hsa-miR-936	CLIP-seq
MIRT823407	hsa-miR-1267	CLIP-seq
MIRT1943469	hsa-miR-1298	CLIP-seq
MIRT823411	hsa-miR-3674	CLIP-seq
MIRT1943470	hsa-miR-3678-3p	CLIP-seq
MIRT1943471	hsa-miR-410	CLIP-seq
MIRT1943472	hsa-miR-4276	CLIP-seq
MIRT823419	hsa-miR-4652-3p	CLIP-seq
MIRT1943473	hsa-miR-4680-3p	CLIP-seq
MIRT823420	hsa-miR-4682	CLIP-seq
MIRT1943474	hsa-miR-4775	CLIP-seq
MIRT1943475	hsa-miR-590-3p	CLIP-seq
MIRT1943476	hsa-miR-664	CLIP-seq
MIRT2182094	hsa-miR-1276	CLIP-seq
MIRT2182095	hsa-miR-145	CLIP-seq
MIRT2182096	hsa-miR-197	CLIP-seq
MIRT2182097	hsa-miR-2467-3p	CLIP-seq
MIRT2182098	hsa-miR-3180-5p	CLIP-seq
MIRT2182099	hsa-miR-3591-5p	CLIP-seq
MIRT2182100	hsa-miR-3660	CLIP-seq
MIRT823411	hsa-miR-3674	CLIP-seq
MIRT1943470	hsa-miR-3678-3p	CLIP-seq
MIRT2182101	hsa-miR-3691-3p	CLIP-seq
MIRT2182102	hsa-miR-3925-3p	CLIP-seq
MIRT1545778	hsa-miR-411	CLIP-seq
MIRT1943472	hsa-miR-4276	CLIP-seq
MIRT2182103	hsa-miR-4277	CLIP-seq
MIRT2182104	hsa-miR-4280	CLIP-seq
MIRT2182105	hsa-miR-4311	CLIP-seq
MIRT2182106	hsa-miR-4328	CLIP-seq
MIRT2182107	hsa-miR-4494	CLIP-seq
MIRT2182108	hsa-miR-4526	CLIP-seq
MIRT823420	hsa-miR-4682	CLIP-seq
MIRT2182109	hsa-miR-4684-3p	CLIP-seq
MIRT2182110	hsa-miR-4765	CLIP-seq
MIRT1943474	hsa-miR-4775	CLIP-seq
MIRT2182111	hsa-miR-4781-3p	CLIP-seq
MIRT2182112	hsa-miR-499a-5p	CLIP-seq
MIRT2182113	hsa-miR-508-5p	CLIP-seq
MIRT823424	hsa-miR-548a-5p	CLIP-seq
MIRT823425	hsa-miR-548ab	CLIP-seq
MIRT823426	hsa-miR-548ak	CLIP-seq
MIRT823427	hsa-miR-548b-5p	CLIP-seq
MIRT823428	hsa-miR-548c-5p	CLIP-seq
MIRT823429	hsa-miR-548d-5p	CLIP-seq
MIRT823432	hsa-miR-548h	CLIP-seq
MIRT823433	hsa-miR-548i	CLIP-seq
MIRT823434	hsa-miR-548j	CLIP-seq
MIRT823435	hsa-miR-548k	CLIP-seq
MIRT823436	hsa-miR-548l	CLIP-seq
MIRT823437	hsa-miR-548w	CLIP-seq
MIRT823438	hsa-miR-548y	CLIP-seq
MIRT823439	hsa-miR-559	CLIP-seq
MIRT2182114	hsa-miR-583	CLIP-seq
MIRT1943475	hsa-miR-590-3p	CLIP-seq
MIRT2182115	hsa-miR-622	CLIP-seq
MIRT2182116	hsa-miR-640	CLIP-seq
MIRT2182117	hsa-miR-759	CLIP-seq
MIRT2182118	hsa-miR-944	CLIP-seq
MIRT823404	hsa-miR-103a	CLIP-seq
MIRT823405	hsa-miR-107	CLIP-seq
MIRT2182099	hsa-miR-3591-5p	CLIP-seq
MIRT823412	hsa-miR-3914	CLIP-seq
MIRT823415	hsa-miR-4310	CLIP-seq
MIRT2485680	hsa-miR-4731-3p	CLIP-seq
MIRT2485681	hsa-miR-4796-5p	CLIP-seq
MIRT2485682	hsa-miR-4801	CLIP-seq
MIRT2182116	hsa-miR-640	CLIP-seq
MIRT2182118	hsa-miR-944	CLIP-seq
MIRT823404	hsa-miR-103a	CLIP-seq
MIRT823405	hsa-miR-107	CLIP-seq
MIRT2182099	hsa-miR-3591-5p	CLIP-seq
MIRT823412	hsa-miR-3914	CLIP-seq
MIRT823415	hsa-miR-4310	CLIP-seq
MIRT2485680	hsa-miR-4731-3p	CLIP-seq
MIRT2485681	hsa-miR-4796-5p	CLIP-seq
MIRT2485682	hsa-miR-4801	CLIP-seq
MIRT2182116	hsa-miR-640	CLIP-seq
MIRT2182118	hsa-miR-944	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
HIF1A	Activation	17848618
HIF1A	Unknown	17513511

Show/Hide all (87)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000422	Process	Autophagy of mitochondrion	NAS	22505714
GO:0000423	Process	Mitophagy	IMP	22505714
GO:0001666	Process	Response to hypoxia	IEA
GO:0001666	Process	Response to hypoxia	ISS
GO:0005515	Function	Protein binding	IPI	7954800, 10381623, 15868100, 16189514, 17360363, 18371312, 19060904, 20436456, 21516116, 22292033, 24981860, 25416956, 27107012, 27499296, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005635	Component	Nuclear envelope	IBA
GO:0005635	Component	Nuclear envelope	IDA	7954800
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	7954800, 9396766, 18371312
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	9973195
GO:0005740	Component	Mitochondrial envelope	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	22505714
GO:0005741	Component	Mitochondrial outer membrane	IDA	10891486, 22292033
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	NAS	22505714
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	22505714
GO:0006915	Process	Apoptotic process	IEA
GO:0009617	Process	Response to bacterium	IEA
GO:0010508	Process	Positive regulation of autophagy	TAS	18309324
GO:0010637	Process	Negative regulation of mitochondrial fusion	IDA	20436456
GO:0010659	Process	Cardiac muscle cell apoptotic process	IEA
GO:0010666	Process	Positive regulation of cardiac muscle cell apoptotic process	IEA
GO:0010917	Process	Negative regulation of mitochondrial membrane potential	IEA
GO:0014069	Component	Postsynaptic density	IEA
GO:0016020	Component	Membrane	IEA
GO:0016239	Process	Positive regulation of macroautophagy	IGI	19273585
GO:0021987	Process	Cerebral cortex development	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031966	Component	Mitochondrial membrane	IDA	10891486
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0031966	Component	Mitochondrial membrane	IMP	9396766
GO:0035694	Process	Mitochondrial protein catabolic process	IMP	22292033
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	10381623, 16189514, 25416956, 27107012, 32296183
GO:0042803	Function	Protein homodimerization activity	IDA	9396766, 10381623
GO:0043065	Process	Positive regulation of apoptotic process	IDA	9973195, 10381623
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043066	Process	Negative regulation of apoptotic process	TAS	7954800
GO:0043068	Process	Positive regulation of programmed cell death	IBA
GO:0043068	Process	Positive regulation of programmed cell death	IDA	10891486
GO:0043069	Process	Negative regulation of programmed cell death	IGI	19273585
GO:0043243	Process	Positive regulation of protein-containing complex disassembly	IDA	20436456
GO:0043653	Process	Mitochondrial fragmentation involved in apoptotic process	IDA	20436456
GO:0045837	Process	Negative regulation of membrane potential	IDA	10891486
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IDA	10891486
GO:0048102	Process	Autophagic cell death	IEA
GO:0048678	Process	Response to axon injury	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0051020	Function	GTPase binding	IPI	20436456
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051402	Process	Neuron apoptotic process	ISS
GO:0051561	Process	Positive regulation of mitochondrial calcium ion concentration	IEA
GO:0051607	Process	Defense response to virus	IDA	9973195
GO:0055093	Process	Response to hyperoxia	IEA
GO:0061709	Process	Reticulophagy	IMP	22505714
GO:0061753	Process	Substrate localization to autophagosome	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP
GO:0071279	Process	Cellular response to cobalt ion	IMP	20436456
GO:0071456	Process	Cellular response to hypoxia	IEA
GO:0071456	Process	Cellular response to hypoxia	IGI	19273585
GO:0071456	Process	Cellular response to hypoxia	IMP	20436456
GO:0072593	Process	Reactive oxygen species metabolic process	IDA	10891486
GO:0090141	Process	Positive regulation of mitochondrial fission	IDA	20436456
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IDA	20436456
GO:0090649	Process	Response to oxygen-glucose deprivation	IEA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IEA
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IBA
GO:0097345	Process	Mitochondrial outer membrane permeabilization	IDA	18371312
GO:0140506	Function	Endoplasmic reticulum-autophagosome adaptor activity	IDA	22505714
GO:0140507	Process	Granzyme-mediated programmed cell death signaling pathway	IDA	9396766
GO:0140580	Function	Mitochondrion autophagosome adaptor activity	IDA	22505714
GO:1902109	Process	Negative regulation of mitochondrial membrane permeability involved in apoptotic process	IEA
GO:1903599	Process	Positive regulation of autophagy of mitochondrion	IEA
GO:1990144	Process	Intrinsic apoptotic signaling pathway in response to hypoxia	IMP	20436456

MIM	HGNC	e!Ensembl
603293	1084	ENSG00000176171

Q12983

Protein name

BCL2/adenovirus E1B 19 kDa protein-interacting protein 3

Protein function

Apoptosis-inducing protein that can overcome BCL2 suppression. May play a role in repartitioning calcium between the two major intracellular calcium stores in association with BCL2. Involved in mitochondrial quality control via its interaction w

PDB

2J5D , 2KA1 , 2KA2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06553	BNIP3	68 → 259	BNIP3	Family

Sequence

MGDAAADPPGPALPCEFLRPGCGAPLSPGAQLGRGAPTSAFPPPAAEAHPAARRGLRSPQ
LPSGAMSQNGAPGMQEESLQGSWVELHFSNNGNGGSVPASVSIYNGDMEKILLDAQHESG
RSSSKSSHCDSPPRSQTPQDTNRASETDTHSIGEKNSSQSEEDDIERRKEVESILKKNSD
WIWDWSSRPENIPPKEFLFKHPKRTATLSMRNTSVMKKGGIFSAEFLKVFLPSLLLSHLL
AIGLGIYIGRRLTTSTSTF

Sequence length

259

Interactions

View interactions

	KEGG
	FoxO signaling pathway Mitophagy - animal Autophagy - animal Shigellosis Legionellosis

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (188)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute leukemia	Leukemia	BEFREE	18092960		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	18092960, 18728663		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	29137361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	25769455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	16954163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	25769455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	28257096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	16827797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	19657213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	31794795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	31794795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	25769455		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35690741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	31509440		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	35605642	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	23807219, 29375685, 29921652, 30744415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	31707369		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29287594	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16740734, 17255267, 18092960, 23934182, 24811485, 26298722, 27746856, 30697531, 30922314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19505343, 27746856, 29287594, 32736587, 34226298, 37610095, 37649051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17255267, 18092960, 23216071, 26232338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	28257096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Adenoid Cystic	Adenoid cystic carcinoma	Pubtator	25769455, 26323347, 26847304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	25181405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	25031766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12521301	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	12521301, 17717605, 28869833, 33602168	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	25031766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Medullary	Medullary carcinoma	Pubtator	28257096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25950386, 30338933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20808857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	21057536, 34779489, 35308143, 37649051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30365137	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	20849603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31081079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinomatosis of peritoneal cavity	Peritoneal Carcinomatosis	BEFREE	27807188		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ceroid Lipofuscinosis Neuronal 2	Neuronal ceroid lipofuscinosis	Pubtator	23249249	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21711117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21711117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	25081716	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30607007		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29939786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	26290261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29943813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21911457, 26169282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	32851835	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18728663, 19956881, 22213796, 23364257, 28222492, 28607593, 29063978		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	16799636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18728663	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	19641503, 27112557, 30744415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15964822, 16322756, 30365137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	33964876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30683904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	30683904		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	30147831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31794795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	25232961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	25232961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	25232961, 27893424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ethylmalonic encephalopathy	Ethylmalonic Encephalopathy	BEFREE	30147831		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	25181405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29609842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular thyroid carcinoma	Follicular Thyroid Carcinoma	BEFREE	28257096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	LHGDN	15709167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	16217754		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	16217754, 19339613, 26467103	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	23147506, 26467103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19339613, 23579274, 26467103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18670645, 19339613, 26467103, 32135176, 32597148	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23579274, 28977881, 30307949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	33799647, 35605642	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	19229244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	20022263	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	19641503, 27112557, 30744415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	35563877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	26358776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	28819333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30596897, 30877409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	23934182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15756280, 15790403, 16217754, 16803523, 19802386, 21984181, 25081716, 25769455, 26467103, 28000962, 29207102, 32351020, 35690741	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17763440, 18059169, 18670645, 19505343, 20436456, 20637734, 21573703, 23291726, 24200883, 26102349, 31078780, 33478328, 33496385	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	30704780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	31515472		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	22458929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15756280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15756280, 39519080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12215374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12521301, 21911457, 25052749, 28869833, 30940322, 31835431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21911457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	15328198, 16765911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20849603, 30338933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25950386	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	16827797, 25081716, 36454866	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19505343	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	LHGDN	17394490		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28977881		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16740734, 17255267, 23934182, 24811485, 25140630, 26298722, 30697531, 30922314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	25232961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	15709167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	25950386, 30338933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31081079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	15289340, 15837765, 15856026, 15942716, 17729412, 28167504, 28968982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18163427, 23979608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	18163427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15709167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10993958, 16954163, 18092960, 19229244, 19942427, 24625986, 25052749, 25769455, 25950386, 26432836, 28607593, 28821609, 28859361, 28869833, 29445175, 29707136, 30664690 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21711117		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26169282		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17255267, 26232272, 30922314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17255267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis Systemic	Systemic mastocytosis	Pubtator	36333264	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28257096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	28257096		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24625986, 29312568, 29707136, 29924728		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	27858285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	10891486, 22505714, 25891311, 28869833, 33496385, 34095303, 34650122, 36129061, 36928344, 40445405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	26102349	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	18172295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	15756280, 18172295, 19196658		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	15756280	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	17848618, 19690192, 34189969, 37401850	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	18172295		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	38038045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloproliferative Disorders	Myeloproliferative disorder	Pubtator	26290261	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30743213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	38240888	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyp	Pubtator	35747690	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	33313953, 33795637, 38149563, 40083705	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	10891486, 25950386, 32412667	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	16002567		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14648660, 15709167, 15856026, 16954163, 17255267, 17576813, 18728663, 19339613, 20570889, 23579274, 24448385, 24811485, 25719198, 26232272, 26467103, 28968982, 30922314, 31839365 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	24928088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24928088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	24824755	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28981157, 29609842, 30056271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15328198, 23216071		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	14648660, 17255267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	LHGDN	17255267		★★★★★ ★☆☆☆☆ Found in Text Mining only
Norrie disease	Norrie Disease	BEFREE	28944876		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy 1	Optic Atrophy	BEFREE	27861891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy Hereditary Leber	Leber hereditary optic neuropathy	Pubtator	31584786	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy Hereditary Leber	Leber hereditary optic neuropathy	Pubtator	32157656	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
OPTIC ATROPHY WITH OR WITHOUT DEAFNESS, OPHTHALMOPLEGIA, MYOPATHY, ATAXIA, AND NEUROPATHY	Optic Atrophy With Or Without Deafness, Ophthalmoplegia, Myopathy, Ataxia, And Neuropathy	BEFREE	27861891		★★★★★ ★☆☆☆☆ Found in Text Mining only
Optic Atrophy, Hereditary, Leber	Hereditary Leber Optic Atrophy	BEFREE	31584786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	36496986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25618603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25618603, 34335109, 35459212, 39174890	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31081079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	27807188, 32412667, 35459212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	15289340, 15837765, 15856026, 15942716, 17729412, 19668230, 28167504, 28968982		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic Cyst	BEFREE	28148542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	15289340, 15856026, 17638890, 17729412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	17729412, 21573703, 24448385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	31622249		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	29230415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic organ prolapse	Pubtator	29230415	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	20082478	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	18838203		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18163427, 23979608		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15790403	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18163427		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	18163427		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30302028	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	15964822, 28918350, 30365137		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	31072291		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	17576813		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Pleomorphic Adenoma	Pleomorphic adenoma of salivary gland	BEFREE	18163427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	37649051	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	20436456	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	28859361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	22458929	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29167529, 29609842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	20082478, 32736677, 40307014	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thiamine Deficiency	Thiamine Deficiency	BEFREE	29045486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	15271793	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	28257096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	28257096	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26232272		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35631261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	BEFREE	28257096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ureteral Obstruction	Urethral obstruction	Pubtator	36928344	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24577895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	16803523, 36499465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	29982263	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	28849201		★★★★★ ★☆☆☆☆ Found in Text Mining only

BNIP3 (BCL2 interacting protein 3)