Gene Gene information from NCBI Gene database.
Entrez ID 6628
Gene name Small nuclear ribonucleoprotein polypeptides B and B1
Gene symbol SNRPB
Synonyms (NCBI Gene)
CCMSCODSNRPB1Sm-B/B'SmB/B'SmB/SmB'snRNP-B
Chromosome 20
Chromosome location 20p13
Summary The protein encoded by this gene is one of several nuclear proteins that are found in common among U1, U2, U4/U6, and U5 small ribonucleoprotein particles (snRNPs). These snRNPs are involved in pre-mRNA splicing, and the encoded protein may also play a ro
SNPs SNP information provided by dbSNP.
4
SNP ID Visualize variation Clinical significance Consequence
rs786201019 C>A,G,T Pathogenic Intron variant
rs786201020 C>A,G Pathogenic Intron variant
rs786201021 G>T Pathogenic Intron variant
rs786201022 G>T Pathogenic 5 prime UTR variant
miRNA miRNA information provided by mirtarbase database.
203
miRTarBase ID miRNA Experiments Reference
MIRT022383 hsa-miR-124-3p Proteomics;Microarray 18668037
MIRT045972 hsa-miR-125b-5p CLASH 23622248
MIRT044720 hsa-miR-320a CLASH 23622248
MIRT041541 hsa-miR-193b-3p CLASH 23622248
MIRT508961 hsa-miR-4428 PAR-CLIP 20371350
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
64
GO ID Ontology Definition Evidence Reference
GO:0000387 Process Spliceosomal snRNP assembly IDA 18984161
GO:0000398 Process MRNA splicing, via spliceosome IBA
GO:0000398 Process MRNA splicing, via spliceosome IC 11991638
GO:0000398 Process MRNA splicing, via spliceosome IDA 28076346, 28781166, 32494006, 36797247
GO:0000398 Process MRNA splicing, via spliceosome NAS 15564372, 30975767, 31744343, 33677607
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
182282 11153 ENSG00000125835
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P14678
Protein name Small nuclear ribonucleoprotein-associated proteins B and B' (snRNP-B) (Sm protein B/B') (Sm-B/B') (SmB/B')
Protein function Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome (PubMed:11991638, PubMed:18984161, PubMed:19325628, PubMed:25555158, Pu
PDB 1D3B , 3CW1 , 3JCR , 3PGW , 4PJO , 4WZJ , 5MQF , 5O9Z , 5XJC , 5YZG , 5Z56 , 5Z57 , 5Z58 , 6AH0 , 6FF7 , 6ICZ , 6ID0 , 6ID1 , 6QDV , 6QW6 , 6QX9 , 6V4X , 6Y53 , 6Y5Q , 7A5P , 7ABG , 7ABI , 7DVQ , 7EVO , 7QTT , 7VPX , 7W59 , 7W5A , 7W5B , 8C6J , 8CH6 , 8H6E , 8H6J , 8H6K , 8H6L , 8HK1 , 8I0P , 8I0R , 8I0S , 8I0T , 8I0U , 8I0V , 8I0W , 8Q7Q , 8Q7V , 8Q7W
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01423 LSM 7 82 LSM domain Domain
Sequence
MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAE
REEKRVLGLVLLRGENLVSMTV
EGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPM
PQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATASIAGAPTQYPPGRGGPPPPMG
RGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
Sequence length 240
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Spliceosome
Systemic lupus erythematosus
  SLBP independent Processing of Histone Pre-mRNAs
snRNP Assembly
mRNA Splicing - Major Pathway
mRNA Splicing - Minor Pathway
RNA Polymerase II Transcription Termination
SLBP Dependent Processing of Replication-Dependent Histone Pre-mRNAs
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
16
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Cerebro-costo-mandibular syndrome Likely pathogenic; Pathogenic rs786201019, rs786201020, rs786201021, rs786201022, rs2514423027 RCV000162249
RCV000162250
RCV000162251
RCV000162252
RCV000162253
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual disability Likely pathogenic rs2085044676 RCV001261285
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Isolated Pierre-Robin syndrome Likely pathogenic rs2085044676 RCV001261285
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SNRPB-related disorder Likely pathogenic; Pathogenic rs786201019 RCV003416031
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
CEREBROCOSTOMANDIBULAR SYNDROME CTD, Disgenet, GenCC, HPO, Orphanet
CTD, Disgenet, GenCC, HPO, Orphanet
CTD, Disgenet, GenCC, HPO, Orphanet
CTD, Disgenet, GenCC, HPO, Orphanet
CTD, Disgenet, GenCC, HPO, Orphanet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Familial cancer of breast Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acquired porencephaly Acquired Porencephaly HPO_DG
★☆☆☆☆
Found in Text Mining only
Acrofacial Dysostosis Acrofacial Dysostosis BEFREE 25865758
★☆☆☆☆
Found in Text Mining only
Atrial Septal Defects Atrial Septal Defect HPO_DG
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 20418484 Associate
★☆☆☆☆
Found in Text Mining only
Byzanthine arch palate High palate HPO_DG
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 33289700, 38189879 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 35617983 Associate
★☆☆☆☆
Found in Text Mining only
Cardiomyopathies Cardiomyopathy Pubtator 32631246 Associate
★☆☆☆☆
Found in Text Mining only
Cerebrocostomandibular Syndrome Cerebrocostomandibular Syndrome BEFREE 25047197, 25504470, 25865758, 26971886
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cerebrocostomandibular Syndrome Cerebrocostomandibular Syndrome ORPHANET_DG 25047197
★★☆☆☆
Found in Text Mining + Unknown/Other Associations