SNCA (synuclein alpha)

Gene

• Entrez ID: 6622
• Gene name: Synuclein alpha
• Gene symbol: SNCA
• Synonyms (NCBI Gene): NACP, PARK1, PARK4, PD1
• Chromosome: 4
• Chromosome location: 4q22.1
• Summary: Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynapti

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs104893875	C>T	Pathogenic	Missense variant, non coding transcript variant, genic upstream transcript variant, coding sequence variant
rs104893877	C>T	Pathogenic	Missense variant, non coding transcript variant, genic upstream transcript variant, coding sequence variant
rs144758871	C>T	Conflicting-interpretations-of-pathogenicity	Synonymous variant, genic upstream transcript variant, non coding transcript variant, coding sequence variant
rs201106962	A>C	Pathogenic, uncertain-significance	Coding sequence variant, genic upstream transcript variant, non coding transcript variant, missense variant
rs431905511	C>T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant, genic upstream transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT000032	hsa-miR-7-5p	qRT-PCR, Luciferase reporter assay, Western blot	19628698
MIRT000032	hsa-miR-7-5p	Luciferase reporter assay	19628698
MIRT000032	hsa-miR-7-5p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	20106983
MIRT004733	hsa-miR-153-3p	Immunocytochemistry, Luciferase reporter assay, qRT-PCR, Western blot	20106983
MIRT054335	mmu-miR-153-3p	Luciferase reporter assay, qRT-PCR, Western blot	23595248
MIRT1375401	hsa-miR-1279	CLIP-seq
MIRT1375402	hsa-miR-3074-5p	CLIP-seq
MIRT1375403	hsa-miR-3607-3p	CLIP-seq
MIRT1375404	hsa-miR-3910	CLIP-seq
MIRT1375405	hsa-miR-3915	CLIP-seq
MIRT1375406	hsa-miR-3928	CLIP-seq
MIRT1375407	hsa-miR-4261	CLIP-seq
MIRT1375408	hsa-miR-4447	CLIP-seq
MIRT1375409	hsa-miR-4472	CLIP-seq
MIRT1375410	hsa-miR-4481	CLIP-seq
MIRT1375411	hsa-miR-4484	CLIP-seq
MIRT1375412	hsa-miR-4488	CLIP-seq
MIRT1375413	hsa-miR-4496	CLIP-seq
MIRT1375414	hsa-miR-4663	CLIP-seq
MIRT1375415	hsa-miR-4697-5p	CLIP-seq
MIRT1375416	hsa-miR-4728-3p	CLIP-seq
MIRT1375417	hsa-miR-4736	CLIP-seq
MIRT1375418	hsa-miR-4745-5p	CLIP-seq
MIRT1375419	hsa-miR-4758-5p	CLIP-seq
MIRT1375420	hsa-miR-486-3p	CLIP-seq
MIRT1375421	hsa-miR-486-5p	CLIP-seq
MIRT1375422	hsa-miR-494	CLIP-seq
MIRT1375423	hsa-miR-548an	CLIP-seq
MIRT2334796	hsa-miR-3614-5p	CLIP-seq
MIRT2334797	hsa-miR-421	CLIP-seq
MIRT2334798	hsa-miR-4286	CLIP-seq
MIRT2334799	hsa-miR-4691-5p	CLIP-seq
MIRT2691601	hsa-miR-1236	CLIP-seq
MIRT2691602	hsa-miR-1244	CLIP-seq
MIRT2691603	hsa-miR-1301	CLIP-seq
MIRT2691604	hsa-miR-3137	CLIP-seq
MIRT2691605	hsa-miR-3664-5p	CLIP-seq
MIRT2691606	hsa-miR-4474-5p	CLIP-seq
MIRT2691607	hsa-miR-4643	CLIP-seq
MIRT2691608	hsa-miR-4660	CLIP-seq
MIRT2691609	hsa-miR-5047	CLIP-seq
MIRT2691610	hsa-miR-642b	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	TAS	24252804
GO:0000149	Function	SNARE binding	IDA	20798282
GO:0000287	Function	Magnesium ion binding	IDA	11850416
GO:0000976	Function	Transcription cis-regulatory region binding	TAS	24252804
GO:0001774	Process	Microglial cell activation	IEA
GO:0001774	Process	Microglial cell activation	TAS	24252804
GO:0001921	Process	Positive regulation of receptor recycling	IDA	18980610
GO:0001956	Process	Positive regulation of neurotransmitter secretion	IEA
GO:0001963	Process	Synaptic transmission, dopaminergic	IEA
GO:0003779	Function	Actin binding	IPI	18331289
GO:0004857	Function	Enzyme inhibitor activity	IDA	11943812
GO:0004860	Function	Protein kinase inhibitor activity	TAS	30194957
GO:0004869	Function	Cysteine-type endopeptidase inhibitor activity	IDA	10818098
GO:0005504	Function	Fatty acid binding	IDA	16687662
GO:0005507	Function	Copper ion binding	IDA	21319811, 21320589
GO:0005509	Function	Calcium ion binding	IDA	11312271, 11850416
GO:0005515	Function	Protein binding	IPI	10319874, 11943812, 11956199, 12044636, 12059041, 12958153, 15207266, 15590652, 15671022, 16595633, 16882008, 17027006, 17156375, 18331289, 19549071, 19762560, 20798282, 21320589, 21798244, 21985244, 22119730, 22163275, 22854022, 23183827, 24412932, 24895406, 25241761, 26643113, 269
GO:0005543	Function	Phospholipid binding	IDA	17222866
GO:0005543	Function	Phospholipid binding	IEA
GO:0005576	Component	Extracellular region	IDA	15863497
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	24936070
GO:0005634	Component	Nucleus	IDA	12406186, 16959795, 17408955, 24936070
GO:0005634	Component	Nucleus	IEA
GO:0005640	Component	Nuclear outer membrane	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	12406186, 12958153, 15863497, 16959795, 17408955, 23983262, 24403142, 25561023
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	24252804
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005764	Component	Lysosome	TAS	24477431
GO:0005829	Component	Cytosol	IDA	8248242, 24936070, 31034892
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005840	Component	Ribosome	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	12958153, 15641770, 17222866
GO:0005886	Component	Plasma membrane	IEA
GO:0005938	Component	Cell cortex	IDA	19157893
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006638	Process	Neutral lipid metabolic process	IEA
GO:0006644	Process	Phospholipid metabolic process	IEA
GO:0006749	Process	Glutathione metabolic process	IDA	23507046
GO:0007006	Process	Mitochondrial membrane organization	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007269	Process	Neurotransmitter secretion	IEA
GO:0008017	Function	Microtubule binding	IEA
GO:0008021	Component	Synaptic vesicle	IEA
GO:0008047	Function	Enzyme activator activity	IDA	23507046
GO:0008198	Function	Ferrous iron binding	IDA	11850416
GO:0008270	Function	Zinc ion binding	IDA	11850416
GO:0008289	Function	Lipid binding	EXP	11286556, 20524659, 22315227
GO:0008289	Function	Lipid binding	IDA	8901511
GO:0008344	Process	Adult locomotory behavior	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0010040	Process	Response to iron(II) ion	IDA	11850416
GO:0010642	Process	Negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	12239163
GO:0014048	Process	Regulation of glutamate secretion	IEA
GO:0014059	Process	Regulation of dopamine secretion	IEA
GO:0014059	Process	Regulation of dopamine secretion	IEA
GO:0014059	Process	Regulation of dopamine secretion	TAS	21320589
GO:0015629	Component	Actin cytoskeleton	IDA	17408955
GO:0016020	Component	Membrane	IDA	24936070
GO:0016020	Component	Membrane	IEA
GO:0016079	Process	Synaptic vesicle exocytosis	IDA	28288128
GO:0016082	Process	Synaptic vesicle priming	IMP	30404828
GO:0016234	Component	Inclusion body	IDA	17222866, 20039155
GO:0016234	Component	Inclusion body	IEA
GO:0016491	Function	Oxidoreductase activity	IDA	21320589
GO:0019894	Function	Kinesin binding	IPI	16176937
GO:0019899	Function	Enzyme binding	IEA
GO:0019899	Function	Enzyme binding	IPI	23507046
GO:0019904	Function	Protein domain specific binding	IEA
GO:0030424	Component	Axon	IDA	12958153
GO:0030424	Component	Axon	IEA
GO:0030426	Component	Growth cone	IDA	12958153
GO:0030426	Component	Growth cone	IEA
GO:0030544	Function	Hsp70 protein binding	IPI	18975920
GO:0030659	Component	Cytoplasmic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0031092	Component	Platelet alpha granule membrane	IDA	12239163
GO:0031115	Process	Negative regulation of microtubule polymerization	IDA	21127069
GO:0031623	Process	Receptor internalization	IDA	18980610
GO:0031648	Process	Protein destabilization	IDA	21320589
GO:0032026	Process	Response to magnesium ion	IDA	11850416
GO:0032496	Process	Response to lipopolysaccharide	IDA	12406186
GO:0032991	Component	Protein-containing complex	IMP	31034892
GO:0034341	Process	Response to type II interferon	IDA	19157893
GO:0034599	Process	Cellular response to oxidative stress	IDA	23507046
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0035493	Process	SNARE complex assembly	IDA	20798282
GO:0035493	Process	SNARE complex assembly	IEA
GO:0035543	Process	Positive regulation of SNARE complex assembly	IDA	20798282
GO:0040012	Process	Regulation of locomotion	IEA
GO:0042220	Process	Response to cocaine	IEA
GO:0042393	Function	Histone binding	IDA	16959795
GO:0042393	Function	Histone binding	IEA
GO:0042416	Process	Dopamine biosynthetic process	IEA
GO:0042416	Process	Dopamine biosynthetic process	TAS	21320589
GO:0042417	Process	Dopamine metabolic process	IEA
GO:0042775	Process	Mitochondrial ATP synthesis coupled electron transport	IEA
GO:0042802	Function	Identical protein binding	IDA	24936070, 25561023
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	15502874, 16330551, 16764865, 18550842, 18614564, 19745811, 19875982, 21358815, 21443877, 22119730, 22854022, 23927048, 24374342, 24895406, 24983211, 25643172, 25732184, 27018801, 31270237, 31695184, 32461689, 34860005
GO:0042995	Component	Cell projection	IEA
GO:0043014	Function	Alpha-tubulin binding	IPI	11698390
GO:0043025	Component	Neuronal cell body	IBA
GO:0043025	Component	Neuronal cell body	IEA
GO:0043030	Process	Regulation of macrophage activation	IEA
GO:0043065	Process	Positive regulation of apoptotic process	TAS	24252804
GO:0043066	Process	Negative regulation of apoptotic process	IMP	10818098
GO:0043195	Component	Terminal bouton	IEA
GO:0043274	Function	Phospholipase binding	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043679	Component	Axon terminus	IBA
GO:0043679	Component	Axon terminus	IEA
GO:0044344	Process	Cellular response to fibroblast growth factor stimulus	IEA
GO:0045202	Component	Synapse	IEA
GO:0045807	Process	Positive regulation of endocytosis	IDA	18980610
GO:0045920	Process	Negative regulation of exocytosis	IMP	12239163
GO:0045921	Process	Positive regulation of exocytosis	IMP	30404828
GO:0045963	Process	Negative regulation of dopamine metabolic process	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0046928	Process	Regulation of neurotransmitter secretion	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0048156	Function	Tau protein binding	IDA	17408955, 21127069
GO:0048168	Process	Regulation of neuronal synaptic plasticity	IEA
GO:0048169	Process	Regulation of long-term neuronal synaptic plasticity	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	20039155
GO:0048487	Function	Beta-tubulin binding	IEA
GO:0048488	Process	Synaptic vesicle endocytosis	IBA
GO:0048488	Process	Synaptic vesicle endocytosis	IEA
GO:0048488	Process	Synaptic vesicle endocytosis	ISS
GO:0048489	Process	Synaptic vesicle transport	IEA
GO:0050729	Process	Positive regulation of inflammatory response	IDA	25533483
GO:0050806	Process	Positive regulation of synaptic transmission	IEA
GO:0050808	Process	Synapse organization	IBA
GO:0050808	Process	Synapse organization	IEA
GO:0050812	Process	Regulation of acyl-CoA biosynthetic process	IEA
GO:0051219	Function	Phosphoprotein binding	IDA	21127069
GO:0051259	Process	Protein complex oligomerization	IEA
GO:0051262	Process	Protein tetramerization	IDA	21841800
GO:0051281	Process	Positive regulation of release of sequestered calcium ion into cytosol	IDA	15641770
GO:0051402	Process	Neuron apoptotic process	IEA
GO:0051583	Process	Dopamine uptake involved in synaptic transmission	TAS	21320589
GO:0051585	Process	Negative regulation of dopamine uptake involved in synaptic transmission	IDA	12958153
GO:0051612	Process	Negative regulation of serotonin uptake	IDA	16882008
GO:0051621	Process	Regulation of norepinephrine uptake	IGI	18331289
GO:0051622	Process	Negative regulation of norepinephrine uptake	IDA	17156375
GO:0055074	Process	Calcium ion homeostasis	IDA	12239163
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0060090	Function	Molecular adaptor activity	EXP	11286556
GO:0060291	Process	Long-term synaptic potentiation	IEA
GO:0060732	Process	Positive regulation of inositol phosphate biosynthetic process	IDA	15641770
GO:0060961	Function	Phospholipase D inhibitor activity	IDA	19146388
GO:0061024	Process	Membrane organization	IEA
GO:0070495	Process	Negative regulation of thrombin-activated receptor signaling pathway	IDA	12239163
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	ISS
GO:0070555	Process	Response to interleukin-1	IDA	12406186
GO:0070840	Function	Dynein complex binding	IPI	16176937
GO:0071280	Process	Cellular response to copper ion	IDA	21320589
GO:0071872	Process	Cellular response to epinephrine stimulus	TAS	21320589
GO:0097435	Process	Supramolecular fiber organization	TAS	21320589
GO:0098793	Component	Presynapse	IEA
GO:0098794	Component	Postsynapse	IEA
GO:0099512	Component	Supramolecular fiber	IDA	17222866, 18346205, 23507046
GO:0140311	Function	Protein sequestering activity	IDA	23507046
GO:0141108	Function	Transporter regulator activity	IGI	18331289
GO:1902957	Process	Negative regulation of mitochondrial electron transport, NADH to ubiquinone	TAS	24252804
GO:1903136	Function	Cuprous ion binding	IBA
GO:1903136	Function	Cuprous ion binding	IEA
GO:1903136	Function	Cuprous ion binding	IMP	25495902
GO:1903285	Process	Positive regulation of hydrogen peroxide catabolic process	IDA	23507046
GO:1903421	Process	Regulation of synaptic vesicle recycling	TAS	23983262
GO:1903426	Process	Regulation of reactive oxygen species biosynthetic process	TAS	24252804
GO:1904307	Process	Response to desipramine	IEA
GO:1904377	Process	Positive regulation of protein localization to cell periphery	IGI	25533483
GO:1904715	Process	Negative regulation of chaperone-mediated autophagy	IMP	20697033
GO:1905606	Process	Regulation of presynapse assembly	IGI	25533483
GO:1990000	Process	Amyloid fibril formation	EXP	8901511
GO:2000377	Process	Regulation of reactive oxygen species metabolic process	IEA

Other IDs

• MIM: 163890
• HGNC: 11138
• e!Ensembl: ENSG00000145335

Protein

• UniProt ID: P37840
• Protein name: Alpha-synuclein (Non-A beta component of AD amyloid) (Non-A4 component of amyloid precursor) (NACP)
• Protein function: Neuronal protein that plays several roles in synaptic activity such as regulation of synaptic vesicle trafficking and subsequent neurotransmitter release (PubMed:20798282, PubMed:26442590, PubMed:28288128, PubMed:30404828). Participates as a mon
• PDB: 1XQ8, 2JN5, 2KKW, 2M55, 2N0A, 2X6M, 3Q25, 3Q26, 3Q27, 3Q28, 3Q29, 4BXL, 4R0U, 4R0W, 4RIK, 4RIL, 4ZNN, 5CRW, 6A6B, 6CT7, 6CU7, 6CU8, 6H6B, 6I42, 6L1T, 6L1U, 6L4S, 6LRQ, 6OSJ, 6OSL, 6OSM, 6PEO, 6PES, 6RT0, 6RTB, 6SST, 6SSX, 6UFR, 6XYO, 6XYP, 6XYQ, 7C1D, 7E0F, 7L7H, 7LC9, 7NCA, 7NCG, 7NCH, 7NCI, 7NCJ, 7NCK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01387	Synuclein	1 → 131	Synuclein	Family

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in presynaptic terminals in the central nervous system. Expressed principally in brain. {ECO:0000269|PubMed:8194594}.
• Sequence:

  MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTK
  EQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDP
  DNEAYEMPSEEGYQDYEPEA

• Sequence length: 140

Pathways

KEGG:

Alzheimer disease
Parkinson disease
Pathways of neurodegeneration - multiple diseases

Reactome:

Amyloid fiber formation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal dominant Parkinson disease 1	Pathogenic; Likely pathogenic	rs431905511, rs104893877, rs104893878, rs104893875	RCV000083251 RCV000015044 RCV000015045 RCV002514100	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autosomal dominant Parkinson disease 4	Pathogenic	rs104893877	RCV004786261	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lewy body dementia	Pathogenic	rs104893877, rs104893875	RCV000526380 RCV000015047	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ALZHEIMERS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATAXIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOSOMAL DOMINANT LATE ONSET PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY ANEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEGENERATIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA, LEWY BODY	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA, VASCULAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC KETOACIDOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUCHENNE MUSCULAR DYSTROPHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GAUCHER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMIPARKINSONISM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOLENTICULAR DEGENERATION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY LATE ONSET PARKINSON DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY LATE-ONSET PARKINSON DISEASE	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PARKINSONISM OR PARKINSONS DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEWY BODY DISEASE	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEGENERATIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	CTD, ClinGen, Disgenet, GWAS catalog, GenCC CTD, ClinGen, Disgenet, GWAS catalog, GenCC CTD, ClinGen, Disgenet, GWAS catalog, GenCC CTD, ClinGen, Disgenet, GWAS catalog, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 1, AUTOSOMAL DOMINANT	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 4, AUTOSOMAL DOMINANT	—	HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 4, AUTOSOMAL DOMINANT LEWY BODY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease, Dominant	Benign; Uncertain significance; Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, SECONDARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSONIAN-PYRAMIDAL SYNDROME	—	CTD, Orphanet CTD, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHOSES, SUBSTANCE-INDUCED	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SNCA-related disorder	Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vascular dementia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
YOUNG ONSET PARKINSON DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
YOUNG-ONSET PARKINSON DISEASE	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Abnormal male sexual function	Abnormal Male Sexual Function	HPO_DG			★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	26081225		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29300342, 31718573		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	24269733, 28132806, 28810585		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	BEFREE	17653558		★☆☆☆☆ Found in Text Mining only
Adrenoleukodystrophy	Adrenoleukodystrophy	LHGDN	17653558		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29369502		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	23888327		★☆☆☆☆ Found in Text Mining only
Akinesia	Akinesia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander Disease	BEFREE	27133445		★☆☆☆☆ Found in Text Mining only
Alternating hemiplegia of childhood	Alternating hemiplegia of childhood	Pubtator	26323479	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	10407019, 10619569, 15912881, 16825955, 17761424, 19722699, 20024519, 20448034, 21056999, 21613474, 22701727, 23308173, 23603399, 24586351, 24729344, 24731519, 24777780, 26079410, 27184464, 27352802, 30598082, 31165862, 32291284, 32568358, 32794578, 33809978, 34854996, 35471463, 36982820, 37247383, 37898823, 39863324, 40057942, 40318118, 40363838, 40702763, 7568089, 9466562, 9811326	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	30477568, 36142742	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	38256230	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	24777780, 26497684, 30572013, 31655411		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	10319883		★☆☆☆☆ Found in Text Mining only
Amnesia	Amnesia	BEFREE	31168644		★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies Familial	Amyloid neuropathy	Pubtator	12900507	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	10899435, 10940234, 12052525, 18189141, 21832049, 24012632, 24586351, 24885390, 25210774, 26739002, 27021906, 27074540, 28112214, 28123364, 28395086, 28467708, 28548309, 28759722, 28931065, 29364151, 29366673, 29441013, 29520218, 29615762, 29744847, 29755341, 30051958, 30213230, 30605056, 30620188, 30774334, 30849508, 30917651, 31055236, 31301323, 31427526, 31596526, 7601450, 8248242, 8773602		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	LHGDN	18261982		★☆☆☆☆ Found in Text Mining only
AMYLOIDOSIS, HEREDITARY, TRANSTHYRETIN-RELATED	Amyloidosis	BEFREE	22591216		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10809401, 12757887, 15538967, 17023659, 17099894, 17614162, 18031467, 18759352, 20234357, 23884045, 25129240, 26208350, 26561744, 26643113, 27322773, 28373710, 28571556, 29187283, 29305855, 30394813, 31132469, 31252669, 31555895, 31820696		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	18843496		★☆☆☆☆ Found in Text Mining only
Amyotrophic lateral sclerosis 1	Amyotrophic lateral sclerosis	Pubtator	26208350	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Familial	Amyotrophic lateral sclerosis	BEFREE	15538967, 23352207		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	30409527		★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	26232179		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	18799894		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	23938351, 24252179, 26201615, 27211987, 27871051, 30120834		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	GWASCAT_DG	29942085		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	23938351, 24252179, 26201615, 27211987, 27871051, 30120834		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic valve disease	Pubtator	38517804	Associate	★☆☆☆☆ Found in Text Mining only
Aphasia	Aphasia	Pubtator	19632874	Associate	★☆☆☆☆ Found in Text Mining only
Aphasia, Progressive	Aphasia	BEFREE	15804056		★☆☆☆☆ Found in Text Mining only
Aplastic Anemia	Aplastic anemia	BEFREE	23373967		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	12868067, 17012252		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	LHGDN	17012252		★☆☆☆☆ Found in Text Mining only
Ataxia	Ataxia	Pubtator	21601954	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	16621662		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	35138035	Associate	★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	29868450, 39863324	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	31847878	Stimulate	★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	35213388	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	31349020		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	30336803		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	32807774	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15912506, 20178125, 27660198, 30305312, 30319601, 30837941, 30858851		★☆☆☆☆ Found in Text Mining only
Autonomic Nervous System Diseases	Autonomic nervous system disease	Pubtator	17291816, 18571778	Associate	★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	17251522, 17291816, 29508456, 31267577, 31357238		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Juvenile Parkinson Disease	Parkinson Disease	CTD_human_DG	20464527, 22319455, 23046578, 23295396, 26075822, 26558463, 26687234, 27026137, 27324791		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Parkinsonism	Parkinsonian disease	BEFREE	10963357, 11455179, 12378057, 15308306, 18243716, 30423204, 9878203		★☆☆☆☆ Found in Text Mining only
Autosomal Dominant Parkinsonism	Parkinsonian disease	CTD_human_DG	20464527, 22319455, 23046578, 23295396, 26075822, 26558463, 26687234, 27026137, 27324791		★☆☆☆☆ Found in Text Mining only
Autosomal Recessive Parkinsonism	Parkinsonian disease	CTD_human_DG	20464527, 22319455, 23046578, 23295396, 26075822, 26558463, 26687234, 27026137, 27324791		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28115358		★☆☆☆☆ Found in Text Mining only
Basal Ganglia Diseases	Basal ganglia disease	Pubtator	29991596	Associate	★☆☆☆☆ Found in Text Mining only
Blood Coagulation Disorders	Blood coagulation disorder	Pubtator	35346107	Associate	★☆☆☆☆ Found in Text Mining only
Body Weight	Body weight	Pubtator	20074637, 21795716, 22776646, 23349712, 24018986, 25212463, 27445146, 27888296, 28395086, 29243911	Associate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	29379469		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	11588178, 19632874, 26208350, 32707907, 33955002, 36737438	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	21124000	Stimulate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	27478013	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	17189270, 28535114		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	17189270	Associate	★☆☆☆☆ Found in Text Mining only
Brain Stem Neoplasms	Brain stem neoplasms	Pubtator	30472757, 30639209	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10813729, 21113674, 21487727, 29921237		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27081041, 35040589	Associate	★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	18799894		★☆☆☆☆ Found in Text Mining only
Camurati-Engelmann Syndrome	Diaphyseal dysplasia	BEFREE	28181068		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35346107, 35421944	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32148378	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lewis Lung	Lewis lung carcinoma	Pubtator	18366718, 20619503, 22326202, 30472757	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28446615, 30173128		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	35409135	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	25390032	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	27836206, 30394813		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	40332088	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	32739154	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	28768713		★☆☆☆☆ Found in Text Mining only
Cerebellar Ataxia	Cerebellar ataxia	Pubtator	35997131	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Amyloid Angiopathy	Cerebral amyloid angiopathy	BEFREE	12052525, 29865073		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	29379469, 30721406		★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	BEFREE	26340331		★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	29096697		★☆☆☆☆ Found in Text Mining only
Ceroid lipofuscinosis neuronal 5	Neuronal ceroid lipofuscinosis	Pubtator	30655561	Stimulate	★☆☆☆☆ Found in Text Mining only
CEROID LIPOFUSCINOSIS, NEURONAL, 5	Neuronal ceroid lipofuscinosis	BEFREE	30655561		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29369502		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	37532176	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	37532176	Associate	★☆☆☆☆ Found in Text Mining only
Chronobiology Disorders	Chronobiology disorder	Pubtator	33066427	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	26297298		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	26700614		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	18238775, 23705016, 26350119, 27389831, 27802241, 29630637, 30462117		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	19632874, 23603399, 25844871, 26077166, 32002988, 32786148, 33649398, 33983072, 34092653, 35106798, 35179198, 36261424, 39863324, 39888600, 40713844	Associate	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	26220939	Inhibit	★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	35418463	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	23603399, 30477568, 40318118	Stimulate	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	39863324	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	30589944		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25802477, 27341597, 30334238		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21777459, 24362313, 25802477, 34957998	Associate	★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	BEFREE	27677079		★☆☆☆☆ Found in Text Mining only
Congenital clubfoot	Congenital Clubfoot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital musculoskeletal anomalies	Congenital Musculoskeletal Anomalies	BEFREE	22410449		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	22274654		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27491898, 28807336		★☆☆☆☆ Found in Text Mining only
Corticobasal degeneration	Corticobasal Degeneration	BEFREE	31406572		★☆☆☆☆ Found in Text Mining only
Corticobasal Degeneration	Corticobasal degeneration	Pubtator	40135351	Associate	★☆☆☆☆ Found in Text Mining only
Craniocerebral Trauma	Craniocerebral trauma	Pubtator	25370538	Associate	★☆☆☆☆ Found in Text Mining only
Creutzfeldt-Jakob Disease, Sporadic	Creutzfeldt-Jakob disease	BEFREE	27870938, 28321768, 30136097, 30294658		★☆☆☆☆ Found in Text Mining only
Cutaneous Mastocytosis	Cutaneous mastocytosis	BEFREE	23267208		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	27761938		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	31501480	Associate	★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Central Nervous System	Degenerative Diseases, Central Nervous System	CTD_human_DG	17296847, 18514411, 22430071, 26075822		★☆☆☆☆ Found in Text Mining only
Degenerative Diseases, Spinal Cord	Degenerative Diseases, Central Nervous System	CTD_human_DG	17296847, 18514411, 22430071, 26075822		★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	12684441, 39256877	Associate	★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	10619569, 18389263, 18571778, 20599975, 21264917, 21863007, 22178859, 26306801, 27091628, 28395086, 28399184, 32002988, 32291284, 33300824, 33983072, 34092653, 36454869, 36982820, 38048087, 39259788	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	10809401, 11708989, 11733371, 12489918, 12883830, 15172093, 15451224, 15622440, 15655259, 16358335, 16947080, 16951579, 17251522, 17683088, 17918232, 18335262, 18374272, 18413475, 18451726, 18571778, 19006185, 19021752, 19562770, 19735092, 19833540, 19864570, 20522869, 21596773, 21734300, 22013209, 22269890, 22508839, 23254192, 23457019, 24936070, 25450466, 26350119, 27091628, 27283588, 27979356, 28269775, 28419566, 28476636, 28550528, 28582864, 28645308, 28870518, 28910367, 28987181, 29233723, 29843245, 29869713, 29933008, 30083953, 30249789, 30324423, 30423201, 30619023, 30635607, 31102707, 31424413, 31553333, 9811326		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	12576551, 16609851, 16651889, 17017543, 17049244, 18195271, 18571778, 18625222		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia of frontal lobe type	Dementia Of Frontal Lobe	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	25567624		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Demyelinating Diseases	Demyelinating Diseases	BEFREE	16503161		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	25358962	Associate	★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	17420317		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	18799894, 21271299, 25921825, 26077166, 26201615, 26363495, 27745782, 28320136, 28802919, 30482039, 30582885, 31027150, 31040769		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	26077166, 33082300	Associate	★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	31406572		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30622456, 30658140, 30875980		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29536165, 30622456, 30658140, 30875980		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	33832546	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	34882862	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	38256230	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	14617032, 16978382, 17203303, 29750314		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	21571086, 23349488, 26453205, 28702523, 28768713, 29366673, 31827624		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	24018986	Associate	★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	29124790		★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	39334114	Associate	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	14976159		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down syndrome	Pubtator	16959772	Associate	★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	15790531		★☆☆☆☆ Found in Text Mining only
Dysarthria	Dysarthria	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	17251522, 17291816, 26350119, 29508456, 30262379, 31267577, 31357238		★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	21761143		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyssomnias	Dyssomnia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dystonia 12	Dystonia	Pubtator	26323479	Associate	★☆☆☆☆ Found in Text Mining only
Dystonic Disorders	Dystonia	Pubtator	20074637	Associate	★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	18799894, 21271299		★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	29265516		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	25364880		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	21333719		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	35648061	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	26181000		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	30409527		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	28149289, 30308130		★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	18389263	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	27836206		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28848143		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28848143		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	12815663, 22025277, 31102760		★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	LHGDN	12815663		★☆☆☆☆ Found in Text Mining only
Fabry Disease	Fabry disease	Pubtator	37014703	Associate	★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	11708989, 15804056, 22848530, 24860142, 30477568, 9811326		★☆☆☆☆ Found in Text Mining only
Familial Dementia	Dementia	BEFREE	9875730		★☆☆☆☆ Found in Text Mining only
Familial Juvenile Parkinsonism	Parkinsonian disease	CTD_human_DG	20464527, 22319455, 23046578, 23295396, 26075822, 26558463, 26687234, 27026137, 27324791		★☆☆☆☆ Found in Text Mining only
Female sexual dysfunction	Female sexual dysfunction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	10961431, 11260802, 11377973, 12882651, 16609851, 17023659, 21607722, 25003242, 26306801, 28012952, 29755341, 31132469, 9811617		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	25003242, 32786148, 33771571, 40713844	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia With Motor Neuron Disease	Frontotemporal Dementia With Motor Neuron Disease	BEFREE	15023818		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	17614162, 19847305, 20234357, 25567624, 25962793, 29215728, 31555895		★☆☆☆☆ Found in Text Mining only
FRONTOTEMPORAL LOBAR DEGENERATION WITH TDP43 INCLUSIONS, GRN-RELATED	Frontotemporal lobar degeneration with Tdp43 inclusions	BEFREE	17023659		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	28866688	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal inflammation	Gastrointestinal inflammation	BEFREE	30589944		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	BEFREE	30510858		★☆☆☆☆ Found in Text Mining only
Gastroparesis	Gastroparesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher Disease	BEFREE	15464415, 19576930, 22289779, 23580063, 24388731, 24531622, 24599400, 25111979, 26362253, 27019408, 27413154, 28469644, 28847804, 29481565, 29579237, 31188151		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gaucher Disease	Gaucher Disease	CTD_human_DG	19576930		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gaucher Disease	Gaucher disease	Pubtator	21653695, 21742527, 24070323, 29481565, 31669751, 33672048, 34213307, 37189391	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gaucher Disease	Gaucher disease	Pubtator	27413154, 33342090, 40399377	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gaucher Disease, Type 1	Gaucher Disease	CTD_human_DG	19576930		★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 1	Gaucher Disease	BEFREE	24388731, 26362253, 26378614, 27019408, 29310663, 30717266, 31188151		★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 2 (disorder)	Gaucher Disease	CTD_human_DG	19576930		★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 2 (disorder)	Gaucher Disease	BEFREE	27413154		★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 3 (disorder)	Gaucher Disease	CTD_human_DG	19576930		★☆☆☆☆ Found in Text Mining only
Gaucher Disease, Type 3 (disorder)	Gaucher Disease	BEFREE	24599400		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	28115719		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	31004074		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28740252		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	28159635, 31661771		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28159635, 31661771		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	11435921, 15110760		★☆☆☆☆ Found in Text Mining only
Globoid cell leukodystrophy	Globoid Cell Leukodystrophy	BEFREE	24415155, 27638614, 29481565, 30127535		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	29242346	Associate	★☆☆☆☆ Found in Text Mining only
Glutathione Peroxidase Deficiency Hemolytic Anemia possibly due to	Hereditary hemolytic anemia	Pubtator	29466944	Associate	★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30622541		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	28284988		★☆☆☆☆ Found in Text Mining only
Hallervorden-Spatz Syndrome	Pigmentary pallidal degeneration	BEFREE	11724918, 11733371, 12846986, 24252552		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	26350119		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	28399184	Associate	★☆☆☆☆ Found in Text Mining only
Hepatic Form of Wilson Disease	Hepatolenticular degeneration	CTD_human_DG	23519153		★☆☆☆☆ Found in Text Mining only
Hepatolenticular Degeneration	Hepatolenticular Degeneration	CTD_human_DG	23519153		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary late-onset Parkinson disease	Hereditary Parkinson`s Disease	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Huntington Disease	Huntington Disease	BEFREE	14720172, 15352068, 15538967, 16537516, 17182613, 19768774, 21571086, 22010050, 22045698, 22119730, 24248062, 24798551, 29134321, 29305855, 30254002		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	22119730	Associate	★☆☆☆☆ Found in Text Mining only
Hydrocephalus Normal Pressure	Normal pressure hydrocephalus	Pubtator	40200913	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	28109635		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29417441		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	40221968	Stimulate	★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	29345058		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	19931185		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	10961431, 15451224, 17683088, 17932682, 18238775, 18273624, 18413475, 20505094, 21761143, 22356593, 23209687, 23705016, 25954925, 26220939, 26350119, 27389831, 27802241, 28533388, 28550072, 28554411, 28666710, 28784297, 28945221, 29326545, 29376878, 29409704, 29705185, 30050494, 30089615, 30346044, 30423195, 30462117, 30482039, 30958793, 31168644, 31449702, 31623323		★☆☆☆☆ Found in Text Mining only
Infantile Neuroaxonal Dystrophy	Neuroaxonal Dystrophy	BEFREE	27030050		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	31314610		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	29092095, 33832546	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	28866688	Stimulate	★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	30085937		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	26769358, 28476637, 29679389		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31520398		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	15352422		★☆☆☆☆ Found in Text Mining only
KUFOR-RAKEB SYNDROME	Kufor-Rakeb Syndrome	BEFREE	22442086, 26134396		★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	15655258, 15953415, 18769546, 19864570, 22042430, 23175842, 24468877, 25567624, 29278715, 29748975, 29909202, 30582885, 31477175, 31685859		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23666528		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	21264917, 34555853	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	23888327		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy body disease	Pubtator	10391881, 10407019, 10766891, 10915790, 10934254, 11331421, 11438481, 11560921, 11734199, 11744721, 11850416, 11893734, 12213717, 12661766, 12684441, 12716427, 14535945, 14627698, 15026413, 15028717, 15193026, 15605986, 16567160, 16825955, 16847063, 16959772, 17381514, 17391701, 17556099, 17712623, 17761424, 17971075, 18070888, 18297293, 18322396, 18366718, 18382667, 18389263, 18414880, 18436529, 18508479, 18848547, 18957893, 19596443, 19722699, 19860837, 20127702, 20132485, 20141569, 20334701, 20437581, 20683486, 20838799, 20890676, 20972807, 21056999, 21127069, 21689433, 21718702, 21863007, 21907175, 22065755, 22154298, 22326202, 22920859, 22927976, 23133543, 23300640, 23308173, 23474058, 23492776, 23505409, 23576548, 23747310, 24043770, 24121126, 24252509, 24252552, 24434619, 24752924, 24777780, 24973356, 25220617, 25231978, 25393002, 25476568, 25505181, 25617759, 26079410, 26465922, 26506339, 26644467, 26722480, 27080380, 27091628, 27123591, 27226637, 27241718, 27685250, 28057070, 28160067, 28164279, 28232489, 28269775, 28300069, 28395086, 28431219, 28487947, 28877262, 29057912, 29092095, 29146111, 29263008, 29579237, 29603451, 29969391, 30021006, 30448004, 30472757, 30741686, 30805666, 30926586, 31097622, 31136022, 31165862, 31295458, 31695184, 31719530, 31870437, 31937832, 32015135, 32035284, 32145757, 32232888, 32429337, 32486485, 32561678, 32786148, 33066427, 33098308, 33213513, 33274526, 33301617, 33450872, 33579389, 33879716, 33983072, 34115198, 34254125, 34288055, 34381149, 34514546, 34572052, 34685771, 34717775, 34772466, 34948195, 34999780, 35023548, 35141810, 35296366, 35471463, 35486726, 35563582, 35621196, 35729600, 35765761, 36001084, 36174040, 36208776, 36261424, 36371251, 36428966, 36443011, 36464107, 36626307, 36831291, 36871760, 37247383, 37252975, 37463072, 37627228, 37731009, 37853101, 37919529, 37996943, 38366711, 39259788, 39358446, 39363901, 39617169, 39695344, 39888600, 40135351, 40453094, 40522183, 9546347, 9811326	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy Body Disease	BEFREE	10722726, 10934251, 10963357, 10967135, 11279280, 11483242, 11708989, 11816795, 12111846, 12498958, 12597857, 12719631, 12846986, 14528050, 14755719, 15180968, 15193026, 15365127, 15447678, 15483670, 15498564, 15522241, 15590652, 15622440, 15655258, 15655259, 15663960, 15790525, 15890012, 15953415, 15981014, 16001411, 16260788, 16319716, 16380264, 16847063, 16947080, 16951579, 17017543, 17049244, 17204153, 17563248, 17932682, 18039462, 18045903, 18065497, 18238775, 18335262, 18374272, 18413475, 18451726, 18625222, 18769546, 18955133, 19002552, 19071095, 19104444, 19276553, 19628769, 19711118, 19864570, 19878656, 19944097, 20174468, 20197701, 20339856, 20409326, 20522869, 20534649, 20551689, 20697047, 21103359, 21296890, 21472771, 21684335, 21735318, 21863007, 21937912, 22042430, 22060133, 22232559, 22269890, 22327140, 22373667, 22508489, 22560502, 22819391, 23015436, 23175842, 23363402, 24226269, 24502382, 24624994, 24662516, 24752924, 24860142, 24878508, 24885390, 24973356, 24999658, 25355138, 25383638, 25450466, 25573151, 25687905, 25996784, 26362253, 26515689, 26667592, 26948950, 27123591, 27226637, 27306756, 27334403, 27389831, 27474841, 27567856, 27685250, 27746320, 27875637, 27956085, 28028735, 28039370, 28069058, 28086964, 28148299, 28164279, 28170377, 28171705, 28213071, 28213435, 28225193, 28241427, 28269775, 28348546, 28378233, 28395086, 28431219, 28439961, 28440890, 28450268, 28482862, 28495859, 28550528, 28599681, 28645308, 28667178, 28671142, 28676095, 28690195, 28722658, 28794446, 28835999, 28911198, 29064068, 29092095, 29100980, 29111367, 29116402, 29177427, 29180135, 29198173, 29246765, 29278715, 29305919, 29330884, 29382725, 29422107, 29524634, 29536165, 29544548, 29549278, 29555518, 29563864, 29570792, 29579237, 29589283, 29599149, 29608598, 29630637, 29698510, 29716652, 29737566, 29743672, 29748975, 29797340, 29878075, 29896411, 29909202, 29993134, 29996045, 30021006, 30030380, 30040713, 30051532, 30083953, 30092270, 30092810, 30093536, 30125936, 30236861, 30319334, 30341610, 30362073, 30385782, 30440090, 30503177, 30509990, 30528390, 30589955, 30591714, 30650656, 30680679, 30686993, 30706414, 30737468, 30761004, 30771165, 30771184, 30798354, 30805957, 30807982, 31031694, 31033038, 31165862, 31168644, 31175983, 31178684, 31186026, 31189032, 31331359, 31333408, 31338105, 31340844, 31378574, 31449702, 31477175, 31481162, 31504665, 31511061, 31522685, 31553333, 31582232, 31599499, 31603909, 31660655, 31685848, 31685859, 31692132, 31698547, 31734439, 31758740, 31785806, 31816026, 31837422, 9875730		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy Body Disease	UNIPROT_DG	14755719		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy Body Disease	LHGDN	15207266, 15304594, 15622440, 15981014, 16947080, 18362284, 18413475		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy Body Disease	CTD_human_DG	16141792, 19628769		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy body disease	Pubtator	20024519, 34983390	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy Body Disease	GWASCAT_DG	29263008		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy body disease	Pubtator	31733655, 32879386	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy Body Disease	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lewy Body Disease	Lewy Body Disease	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Linear atrophy	Atrophy	BEFREE	24121116		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29967316		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	26297298		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	32148378	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32559455	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	15352422		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	22835828, 24874737	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	15352422		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	15022318, 15352422, 19116915, 20178125, 30305312, 31565862		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	15352422		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	24362313, 28670716		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	24362313	Associate	★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	18385100, 28236214		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	30503177, 31027150		★☆☆☆☆ Found in Text Mining only
Male sexual dysfunction	Male sexual dysfunction	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	19632874	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21487727, 29921237		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	26181000		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28848143		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31015307		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28446615, 30173128		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30394813		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	25053345, 31289580		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27196778, 27541170, 27557786, 28258692, 28281549, 28402953, 28409437, 28670716, 28716069, 28992347, 29147618, 29309048, 29556232, 30178256, 30249505, 30394813, 30521597, 30622541, 30786013, 30875980, 31436822, 31683962, 31719821, 31733578		★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	23267208		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	LHGDN	12783249		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29369502		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	29369502	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20463956, 23028833, 25333933, 32868414, 37286800, 38189631, 39222576, 39511366	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	20948441, 23028833, 25333933, 28363614, 28716069, 8579579		★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	38189631	Stimulate	★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	18799894, 21271299, 25921825, 26077166, 26201615, 26363495, 27745782, 28320136, 28802919, 30482039, 30582885, 31027150, 31040769		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	31229470		★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	29376878, 30477568, 30814356, 31023342, 31186026, 31505809		★☆☆☆☆ Found in Text Mining only
Mitochondrial complex I deficiency	Mitochondrial complex deficiency	Pubtator	18245082	Inhibit	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	21124000, 23804100, 23934919, 24120997, 27866262, 28698628, 28990084, 29899557, 31727879, 31760463, 32359427, 34572052, 34625559, 35175558, 36179692, 36261424, 37047030, 37252975, 39259788	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	32486485, 37178741	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	16503161		★☆☆☆☆ Found in Text Mining only
Motor Disorders	Motor Disorders	BEFREE	30253092, 30718039, 31358653, 31405930, 31640762		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	28362802		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	12062037, 12900507, 15585343, 15655259, 16399671, 18976704, 23463419, 23666528, 23674386, 26880341, 27334403, 28824465, 29064079, 29292725, 31744850, 31768670, 31816026		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	12900507, 30957308, 32879386, 33539026	Associate	★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	19468750		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	BEFREE	22102531		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis Type IIIA	Mucopolysaccharidosis	BEFREE	22102531, 30907009		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12900507	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	28461396		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16503161		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37535585	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	30445232		★☆☆☆☆ Found in Text Mining only
Multiple System Atrophy	Multiple system atrophy	Pubtator	10619569, 10766891, 10915790, 11560921, 11893734, 15028717, 16543523, 17291816, 17712623, 18414880, 19475667, 19722699, 19771175, 20132485, 21601954, 21863007, 23404372, 23948991, 24113558, 24590631, 24728187, 25358962, 25962793, 26208350, 26306801, 26465922, 27226637, 27374978, 27793473, 29115515, 29187220, 29660838, 29850876, 29917054, 30021006, 30203094, 30968343, 31535203, 31695184, 31769073, 31870437, 31937832, 32015135, 32232888, 33189969, 33368549, 34155194, 34255887, 34334418, 35294277, 35746899, 35997131, 36208776, 36371251, 36542090, 36847833, 36871760, 37336145, 37919529, 38143373, 39358446, 39957201, 40135351, 40522183	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	21264917	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	29780824	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	33955002	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20428207, 23028833, 24764579, 25539810, 26181000, 26833127, 27207108, 27491898, 27894751, 28265006, 28913723, 29143824, 29153625, 29167175, 29222272, 29336717, 29369502, 29598887, 30368118, 30617136, 30655605, 30886151, 31132649, 31240875, 31310752, 31436822, 31703637		★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	17785456, 30472757, 34754035, 36752535	Associate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	11060312, 12846986, 16219675, 16595633, 16920272, 17156376, 17893145, 22014436, 22912757, 24252149, 25851527, 27918765, 28132929, 28213437, 28468938, 28797124, 28849371, 29300342, 29623065, 30092810, 30481588, 30514850, 30690664, 31209363, 31230104, 31603207, 31698188		★☆☆☆☆ Found in Text Mining only
Neuroaxonal Dystrophies	Neuroaxonal Dystrophy	BEFREE	22416811		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10799759, 12716427, 12727333, 12923682, 14535945, 14698476, 15122920, 15460447, 16584840, 17131421, 17337120, 19135032, 19457084, 19460457, 20334701, 20596942, 21848810, 21951066, 22060133, 23319586, 24269733, 25207598, 26135068, 26378614, 26503960, 26620202, 27808254, 27837450, 27871937, 28096355, 28102321, 28164279, 28236214, 28516276, 28620826, 28637871, 28768533, 28807729, 28827536, 28870518, 28883518, 29242346, 29375308, 29429047, 29539261, 29551576, 29679389, 29892158, 29974096, 30068273, 30615125, 30926586, 30968030, 31050886, 31100053, 31117342, 31167929, 31209363, 31848207, 9862428		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	10934254, 12716427, 14742448, 21127069, 21848810, 25054189, 25207598, 29242346, 35049152, 37286800, 9862428	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	10075647, 10407019, 10818098, 10952980, 11588178, 11812782, 12239163, 12857790, 12893833, 12900507, 15026413, 16146428, 16464864, 16567160, 16764865, 17573347, 17712623, 18258594, 18508479, 18661559, 18772193, 19013262, 19115126, 19126542, 19141614, 19529773, 19596443, 19722699, 20026050, 20026206, 20733075, 21386983, 21907175, 22404520, 22701727, 23389286, 23594135, 23710708, 24066883, 24728187, 24874737, 24911099, 25220617, 25390032, 25790376, 25844871, 25985292, 26306801, 26582456, 26644467, 27109489, 27123591, 27332068, 27793473, 28131822, 28232489, 28452474, 28487126, 28760825, 29039448, 29092095, 29242346, 29603451, 29991596, 30352158, 30372687, 30448004, 30968343, 31253822, 31507618, 31633065, 31937832, 32240735, 32291284, 32432761, 32739154, 32794578, 32949572, 33804213, 34229155, 34333522, 34334418, 34514546, 34586830, 34846537, 34884786, 35026420, 35179198, 35263701, 35283247, 35325812, 35397003, 35580766, 36142742, 36417521, 36939875, 36948206, 37131250, 37252975, 37365181, 37853101, 37889966, 37996943, 39196271, 39695344, 40106490, 40317721, 9466562, 9801138, 9862427, 9862428	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	24831002	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10075647, 10092675, 10391881, 10491577, 10678833, 10809401, 10813729, 10818098, 10899435, 10940234, 10952980, 10971650, 11032911, 11176955, 11215516, 11260802, 11377973, 11431533, 11435921, 11470957, 11536327, 11708989, 11813001, 12084935, 12111846, 12152780, 12223532, 12239163, 12428718, 12605877, 12719631, 12794302, 12814657, 12819014, 12868067, 12883830, 14579119, 14985429, 15033366, 15123735, 15144854, 15567525, 15581183, 15628878, 15790525, 15890012, 16081040, 16246056, 16260788, 16460685, 16793767, 16794039, 16959793, 17005870, 17237936, 17328689, 17337120, 17374033, 17408955, 17623039, 17653558, 17683088, 17715357, 17955272, 18018483, 18061619, 18065497, 18297066, 18322092, 18322395, 18332041, 18355641, 18382657, 18451726, 18590612, 18855701, 18955133, 19013262, 19126542, 19166904, 19325037, 19352323, 19540308, 19586054, 20026050, 20200163, 20203200, 20209636, 20409326, 20805224, 20816781, 20833719, 20842103, 20947801, 20961626, 21103359, 21193046, 21417633, 21656370, 21735318, 21846727, 22057275, 22060133, 22074330, 22165993, 22176890, 22227187, 22289779, 22292029, 22294286, 22327140, 22442086, 22482450, 22537068, 22591216, 22848530, 22912757, 22944910, 23100443, 23175842, 23209687, 23389286, 23532841, 23630590, 23899170, 23948991, 24066883, 24121116, 24204929, 24262183, 24412932, 24491088, 24494600, 24502382, 24531622, 24586351, 24599400, 24874737, 24887264, 25099932, 25122673, 25370810, 25387331, 25412696, 25434005, 25552648, 25834048, 25946078, 25969543, 25985292, 26190401, 26209472, 26314196, 26363495, 26441009, 26469270, 26481462, 26496712, 26612754, 26627686, 26643113, 26793951, 26923014, 26948950, 26957304, 27004367, 27109470, 27123591, 27133445, 27167053, 27332068, 27334403, 27470584, 27474841, 27629562, 27808254, 27815306, 27838898, 27852849, 27853185, 27863716, 27870938, 27888296, 27918765, 27938414, 27993598, 27998621, 28050792, 28057080, 28068606, 28084443, 28086964, 28108534, 28131822, 28154522, 28212433, 28213435, 28213437, 28225193, 28232489, 28319736, 28324300, 28337642, 28396396, 28419968, 28421539, 28452474, 28487126, 28495859, 28504552, 28516276, 28533388, 28538683, 28550305, 28567002, 28576704, 28585223, 28671142, 28698377, 28732710, 28736195, 28760825, 28764908, 28771510, 28802920, 28805003, 28833174, 28847804, 28883016, 28887769, 28900007, 28910367, 28987181, 29048372, 29054095, 29061112, 29089869, 29092095, 29114657, 29115515, 29116402, 29134321, 29169744, 29185072, 29229832, 29242346, 29270108, 29273222, 29305855, 29308725, 29326640, 29382725, 29417650, 29436735, 29451381, 29478699, 29480226, 29520218, 29544548, 29550546, 29551693, 29589283, 29603451, 29627340, 29662651, 29673913, 29686602, 29698545, 29712958, 29725038, 29738880, 29808713, 29850876, 29863470, 29878075, 29886526, 29924502, 29928254, 29933008, 29959729, 29995210, 29995905, 29996045, 29996119, 30022929, 30026307, 30055132, 30071596, 30076830, 30093536, 30125936, 30135302, 30142698, 30142705, 30173732, 30185433, 30194957, 30213230, 30218400, 30218757, 30233055, 30233307, 30254002, 30277516, 30277753, 30278287, 30288644, 30297502, 30327435, 30341610, 30359535, 30442495, 30510219, 30550795, 30551452, 30591714, 30635607, 30711526, 30723395, 30753527, 30760864, 30771169, 30771181, 30771184, 30776354, 30776494, 30796974, 30798354, 30814356, 30826968, 30849508, 30862161, 30862700, 30871620, 30875980, 30894116, 30905782, 30968343, 30977294, 31004503, 31031582, 31055236, 31064841, 31097622, 31098954, 31105524, 31109378, 31123569, 31128101, 31140178, 31142553, 31170426, 31221716, 31267577, 31293044, 31356747, 31370680, 31379027, 31404721, 31424413, 31433984, 31477175, 31505208, 31507618, 31508228, 31509576, 31553333, 31555088, 31584139, 31599499, 31603909, 31693290, 31699323, 31699325, 31699336, 31724509, 31761041, 31796099, 31834548, 31848207, 9862427, 9862428, 9878203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	LHGDN	12084935, 12714745, 15590652, 16464864, 16595633, 18449945		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodegenerative Disorders	Neurodegenerative Disorders	CTD_human_DG	17296847, 18514411, 22430071, 26075822		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	27339877		★☆☆☆☆ Found in Text Mining only
Neurogenic Urinary Bladder	Neurogenic Urinary Bladder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neuronal Ceroid-Lipofuscinoses	Neuronal Ceroid Lipofuscinosis	BEFREE	24036317		★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	12727333		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	31719821		★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C1	Sphingomyelinase deficiency	BEFREE	15099022		★☆☆☆☆ Found in Text Mining only
Night blindness congenital stationary	Night blindness, congenital stationary	Pubtator	27685250, 35397003, 36142742, 36380732	Associate	★☆☆☆☆ Found in Text Mining only
NON RARE IN EUROPE: Dementia with Lewy body	Dementia With Lewy Body	Orphanet			★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27485075, 28293123, 29658848, 30249170, 30765392, 30769852		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29034829		★☆☆☆☆ Found in Text Mining only
Olivopontocerebellar Atrophies	Olivopontocerebellar Atrophies	BEFREE	30203094		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29750314		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	17189270		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17189270	Associate	★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30394813		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26261572	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31694582		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21448452, 35409135, 37857015	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	29221631		★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Paranoia	Paranoia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Paranoid Disorders	Paranoia	Pubtator	12684441	Associate	★☆☆☆☆ Found in Text Mining only
Parasomnia	Parasomnia	BEFREE	29072553		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	10023110, 10075647, 10092675, 10192768, 10319874, 10319883, 10348463, 10349506, 10370906, 10391881, 10430516, 10434313, 10469843, 10555832, 10567818, 10617630, 10639120, 10665491, 10678833, 10704204, 10722726, 10746727, 10768624, 10793231, 10799759, 10809401, 10818098, 10867800, 10878819, 10899435, 10923991, 10934251, 10934254, 10952980, 10959031, 10961431, 10964596, 10964942, 10965160, 10967135, 10978144, 10983716, 10991669, 11037196, 11080208, 11113617, 11193145, 11193173, 11205133, 11208927, 11215516, 11227130, 11260802, 11261505, 11279280, 11300726, 11309462, 11331421, 11331916, 11356310, 11357958, 11359883, 11377973, 11388653, 11427316, 11431533, 11440819, 11442360, 11472875, 11483242, 11511392, 11532993, 11536327, 11560511, 11572944, 11585599, 11590151, 11590439, 11593272, 11683992, 11701929, 11708989, 11724911, 11724918, 11733371, 11739566, 11744167, 11744721, 11748731, 11748744, 11751692, 11784370, 11806835, 11812148, 11813001, 11814405, 11816795, 11823645, 11825297, 11834592, 11852183, 11916484, 11923443, 11926821, 11935271, 11958831, 12000718, 12025860, 12042811, 12052525, 12056932, 12084935, 12087131, 12088093, 12122208, 12145295, 12210852, 12220378, 12223532, 12231460, 12239163, 12351575, 12352614, 12367530, 12376616, 12392775, 12397073, 12408865, 12421356, 12423244, 12428717, 12428718, 12428732, 12428807, 12435752, 12438441, 12477695, 12493604, 12498958, 12534279, 12534296, 12541013, 12551928, 12597857, 12601150, 12661766, 12666100, 12684441, 12693888, 12716427, 12716914, 12719631, 12722931, 12727333, 12732244, 12752402, 12761037, 12761628, 12784265, 12794302, 12807436, 12814657, 12815663, 12834338, 12846976, 12846979, 12846986, 12868067, 12885775, 12887682, 12900507, 12915459, 12928038, 12941575, 12973692, 14528050, 14535945, 14550771, 14572463, 14579118, 14579119, 14579120, 14583385, 14593166, 14642269, 14680807, 14690528, 14698476, 14718715, 14720204, 14732367, 14755720, 14756800, 14976159, 14978671, 14985429, 14987449, 14991385, 14996933, 15026254, 15064394, 15096050, 15099020, 15103328, 15110760, 15122920, 15126689, 15135042, 15144854, 15155902, 15159488, 15180968, 15182224, 15207921, 15247485, 15289452, 15308306, 15317865, 15322916, 15354386, 15358157, 15365127, 15447678, 15451224, 15451225, 15455394, 15460447, 15474365, 15483670, 15498564, 15522241, 15536128, 15538967, 15542245, 15585343, 15590652, 15628878, 15629758, 15642855, 15655259, 15655264, 15670652, 15672325, 15684072, 15732111, 15744224, 15755545, 15760766, 15767499, 15786467, 15789427, 15790525, 15790531, 15840579, 15895422, 15935070, 15953415, 15955578, 15965975, 16020543, 16020550, 16026116, 16081040, 16102530, 16130111, 16166095, 16171820, 16213628, 16219675, 16230020, 16239241, 16246056, 16250025, 16260788, 16269324, 16303137, 16325180, 16338184, 16358335, 16380264, 16399671, 16406842, 16460685, 16495229, 16500997, 16537516, 16554120, 16567160, 16584840, 16595633, 16604306, 16606366, 16611810, 16678164, 16679557, 16752048, 16794039, 16795004, 16796586, 16806074, 16806952, 16896109, 16901642, 16908976, 16920272, 16928354, 16947080, 16957925, 16959793, 16959795, 16969096, 16973207, 16984000, 16984950, 17000465, 17015225, 17017516, 17017529, 17017530, 17017543, 17034008, 17049244, 17077307, 17078049, 17085780, 17125588, 17131421, 17156376, 17182613, 17189270, 17200685, 17203291, 17209557, 17222866, 17254569, 17292657, 17296554, 17309880, 17316906, 17337120, 17374033, 17408955, 17412603, 17448146, 17451452, 17475220, 17521740, 17522092, 17531291, 17556099, 17563248, 17588900, 17593875, 17620882, 17625105, 17653558, 17680806, 17683088, 17706644, 17715357, 17761553, 17785456, 17872362, 17879265, 17882012, 17893145, 17896793, 17911161, 17914726, 17918232, 17932682, 17939164, 18005066, 18018483, 18036154, 18039462, 18061619, 18065497, 18093566, 18175395, 18178617, 18182484, 18187492, 18189141, 18210157, 18220522, 18238775, 18243716, 18245082, 18252210, 18267241, 18267242, 18297066, 18314273, 18322092, 18322262, 18332041, 18335262, 18346205, 18355641, 18369446, 18382657, 18389263, 18404644, 18413475, 18433772, 18451726, 18463504, 18485051, 18494470, 18505736, 18511044, 18539297, 18550537, 18566453, 18585946, 18590612, 18601999, 18606870, 18617532, 18625222, 18650345, 18669654, 18671754, 18691382, 18692132, 18702517, 18704525, 18708765, 18711724, 18715146, 18769546, 18772193, 18800009, 18808659, 18809839, 18824390, 18834937, 18840530, 18841091, 18848547, 18852892, 18855661, 18951507, 18955133, 18957893, 18976704, 18985386, 18992718, 19006185, 19013262, 19018246, 19021544, 19021752, 19041274, 19047559, 19066512, 19072560, 19074459, 19081538, 19081858, 19088817, 19101702, 19126542, 19133659, 19135032, 19141079, 19152986, 19156451, 19164293, 19166904, 19168133, 19196539, 19220042, 19242547, 19243238, 19246516, 19248830, 19271991, 19276553, 19297401, 19303005, 19328772, 19345133, 19345692, 19369384, 19399246, 19405094, 19409223, 19412953, 19422283, 19436756, 19457084, 19460457, 19476547, 19498036, 19501571, 19505575, 19525899, 19526281, 19540308, 19551456, 19562770, 19576930, 19580781, 19586054, 19597508, 19619507, 19628698, 19646423, 19649707, 19683335, 19686384, 19711118, 19730898, 19740488, 19745811, 19762560, 19768774, 19771175, 19801673, 19808079, 19810772, 19816809, 19833127, 19833540, 19850127, 19852948, 19857570, 19860724, 19860837, 19864173, 19864570, 19878656, 19889641, 19890971, 19892735, 19915575, 19915576, 19943343, 19944097, 20026050, 20036196, 20036828, 20041693, 20070850, 20077428, 20089532, 20091141, 20106867, 20114052, 20127702, 20144654, 20148295, 20152107, 20164329, 20165919, 20187239, 20187244, 20187245, 20197701, 20203178, 20209636, 20221696, 20226185, 20334438, 20334701, 20339856, 20340137, 20368804, 20374434, 20399833, 20409326, 20421364, 20430055, 20437567, 20445049, 20445061, 20448034, 20464527, 20478361, 20484626, 20506312, 20513365, 20522009, 20534649, 20547124, 20551689, 20574962, 20640532, 20648655, 20664293, 20683486, 20696318, 20697047, 20697102, 20733075, 20816781, 20818659, 20833719, 20842103, 20847048, 20876472, 20887871, 20938043, 20939808, 20947801, 20959456, 20961626, 20969957, 20977677, 21044603, 21044948, 21058943, 21060011, 21084426, 21085664, 21091473, 21103359, 21108729, 21124796, 21152247, 21159074, 21184589, 21195766, 21222624, 21237164, 21238487, 21245577, 21248740, 21258085, 21268244, 21272100, 21292315, 21296890, 21320589, 21330368, 21333719, 21338582, 21391235, 21411979, 21412835, 21412942, 21417633, 21425343, 21443877, 21453448, 21462277, 21472771, 21474915, 21488084, 21489994, 21491910, 21520980, 21554732, 21566660, 21571086, 21576917, 21584925, 21596773, 21600984, 21652707, 21653695, 21656370, 21658409, 21683120, 21683963, 21684335, 21693148, 21710541, 21712347, 21718702, 21721555, 21734300, 21735318, 21761319, 21767644, 21767974, 21782946, 21795682, 21800132, 21812969, 21816655, 21819966, 21829596, 21832049, 21844169, 21848810, 21853288, 21863007, 21887711, 21906659, 21936000, 21937912, 21951066, 21953697, 21953863, 21966373, 22003392, 22010050, 22013209, 22014436, 22021190, 22023810, 22025277, 22031823, 22042430, 22045698, 22060133, 22067166, 22073131, 22076805, 22081500, 22090514, 22102531, 22104010, 22110584, 22119730, 22128150, 22155155, 22165993, 22166424, 22166459, 22166460, 22167382, 22182688, 22211740, 22232559, 22233220, 22245218, 22269890, 22275250, 22292029, 22302797, 22323726, 22327140, 22342404, 22342821, 22349157, 22355802, 22356593, 22357653, 22357655, 22361813, 22373667, 22392151, 22399752, 22403010, 22425546, 22426473, 22442086, 22445325, 22451204, 22451330, 22475625, 22480689, 22482450, 22499677, 22503115, 22508489, 22508839, 22513881, 22514658, 22528366, 22537068, 22538490, 22549133, 22553500, 22560502, 22575665, 22583428, 22613205, 22615757, 22617348, 22619171, 22664331, 22669510, 22701661, 22705949, 22718772, 22719003, 22722629, 22727767, 22764233, 22767608, 22771809, 22776006, 22776646, 22814000, 22843682, 22848108, 22848530, 22867958, 22912757, 22921536, 22929188, 22936307, 22944910, 22961477, 23011138, 23015436, 23028833, 23038403, 23054368, 23071545, 23077033, 23100443, 23106139, 23124679, 23127617, 23150342, 23153578, 23154387, 23182315, 23183827, 23184946, 23185535, 23209687, 23223297, 23252394, 23262240, 23300640, 23302418, 23319586, 23349712, 23361255, 23363402, 23383169, 23384565, 23389286, 23390095, 23392688, 23393156, 23404372, 23413261, 23427326, 23444197, 23454680, 23457019, 23457458, 23466428, 23485787, 23492776, 23494678, 23505409, 23512373, 23526723, 23531432, 23532841, 23560093, 23580063, 23587141, 23603979, 23607785, 23626796, 23640536, 23643841, 23644755, 23648364, 23666528, 23674386, 23674490, 23688541, 23703938, 23705016, 23736218, 23737253, 23743292, 23747310, 23757764, 23820587, 23826309, 23867236, 23891486, 23916651, 23935950, 23936403, 23936613, 23938255, 23939307, 23939344, 23939407, 23962496, 23973292, 23983262, 24005725, 24035591, 24036317, 24046356, 24047453, 24058406, 24064060, 24066883, 24068758, 24070323, 24082145, 24119854, 24121116, 24121126, 24126627, 24129513, 24145820, 24148766, 24152121, 24158851, 24158904, 24192137, 24204929, 24239353, 24243558, 24248062, 24252149, 24252179, 24252244, 24262170, 24262183, 24267638, 24269733, 24273027, 24279716, 24290359, 24312298, 24313877, 24361548, 24374342, 24388974, 24398085, 24407237, 24412932, 24415155, 24416384, 24418406, 24430504, 24436092, 24450731, 24452053, 24463035, 24468877, 24477431, 24491088, 24494600, 24502382, 24509835, 24511594, 24511991, 24559643, 24578302, 24586351, 24603074, 24619358, 24624994, 24629672, 24656894, 24662516, 24668939, 24694231, 24694655, 24726430, 24728187, 24742361, 24742669, 24746362, 24749759, 24752924, 24768741, 24773432, 24777780, 24798551, 24823723, 24825319, 24831002, 24833599, 24844147, 24851801, 24854799, 24855640, 24860142, 24863655, 24867919, 24878508, 24879013, 24905915, 24936070, 24950403, 24983211, 24984882, 24990317, 24999658, 25051958, 25058424, 25073522, 25090921, 25092551, 25099932, 25107340, 25111979, 25112864, 25129240, 25156829, 25161148, 25175702, 25178429, 25207598, 25212463, 25216651, 25218777, 25268550, 25307288, 25355420, 25363075, 25370538, 25383638, 25390032, 25391693, 25393002, 25394490, 25416158, 25429104, 25429148, 25434005, 25445041, 25450466, 25451064, 25452431, 25456401, 25461191, 25480524, 25483063, 25497491, 25505181, 25524885, 25541488, 25545759, 25552648, 25554495, 25561023, 25573151, 25588354, 25588356, 25594542, 25623333, 25635052, 25637461, 25656566, 25657004, 25658425, 25665531, 25687905, 25713058, 25714663, 25724482, 25768729, 25802027, 25804954, 25816357, 25817515, 25834048, 25851527, 25853296, 25862939, 25874605, 25886189, 25900096, 25907990, 25909158, 25915624, 25921825, 25954925, 25960998, 25975492, 25982926, 25985082, 25985292, 26002080, 26050140, 26055708, 26057626, 26076669, 26078453, 26083886, 26099628, 26114655, 26134396, 26135068, 26158517, 26167732, 26173746, 26181201, 26190401, 26203864, 26205255, 26208350, 26209472, 26214314, 26220939, 26247888, 26250687, 26272943, 26274610, 26287258, 26295817, 26306801, 26314196, 26315598, 26317803, 26324905, 26332674, 26343921, 26349993, 26350119, 26362253, 26363495, 26378614, 26392130, 26392287, 26422361, 26438087, 26448324, 26453202, 26453205, 26456030, 26465894, 26469270, 26481462, 26490873, 26498265, 26499757, 26501339, 26509433, 26523794, 26578166, 26582456, 26601739, 26606044, 26610207, 26612754, 26620202, 26621506, 26633009, 26643113, 26666562, 26683203, 26687234, 26700614, 26719332, 26732583, 26740081, 26742515, 26743617, 26744328, 26769358, 26776090, 26793951, 26797011, 26813776, 26852372, 26860875, 26905200, 26919570, 26924014, 26948950, 26957304, 26961542, 26972727, 26984067, 26991855, 26995357, 27004367, 27018978, 27030050, 27041685, 27048753, 27074540, 27080380, 27090875, 27091628, 27094865, 27096366, 27101974, 27103567, 27109470, 27112900, 27115672, 27120258, 27123591, 27126635, 27133439, 27191603, 27192974, 27226637, 27260835, 27332068, 27334403, 27335051, 27338353, 27338814, 27339877, 27348587, 27358065, 27378698, 27388550, 27389831, 27393118, 27413154, 27423554, 27424009, 27445146, 27470562, 27474841, 27494837, 27503084, 27508962, 27509067, 27517125, 27535567, 27538639, 27539923, 27546826, 27573854, 27581196, 27585855, 27611012, 27613114, 27613618, 27622765, 27628239, 27637804, 27659705, 27671864, 27708076, 27717584, 27737778, 27741433, 27742354, 27743341, 27745782, 27771352, 27776749, 27777137, 27780739, 27785754, 27803984, 27808254, 27809690, 27816415, 27818201, 27818248, 27837450, 27838048, 27852849, 27859866, 27860069, 27865851, 27866262, 27871937, 27876560, 27881168, 27886407, 27888296, 27894611, 27899296, 27902767, 27918765, 27919712, 27923670, 27938414, 27956085, 27965467, 27966077, 27973581, 27982082, 27993598, 27997067, 28004278, 28007442, 28012952, 28024449, 28025780, 28027392, 28028237, 28028643, 28028735, 28045494, 28052246, 28053029, 28057070, 28062370, 28069058, 28069931, 28075555, 28078311, 28084443, 28086964, 28088342, 28096355, 28096359, 28102321, 28108469, 28108534, 28109635, 28112214, 28116784, 28117497, 28122627, 28126589, 28126640, 28131822, 28131823, 28143577, 28147270, 28148299, 28154193, 28155133, 28164279, 28167231, 28168622, 28170377, 28173842, 28180961, 28186641, 28187263, 28193887, 28195695, 28197072, 28197125, 28202670, 28212433, 28213071, 28213435, 28216145, 28222538, 28224980, 28230073, 28230968, 28232489, 28233934, 28236214, 28237800, 28238838, 28239455, 28241427, 28257421, 28263550, 28273718, 28276260, 28282812, 28288128, 28289371, 28298083, 28300069, 28320136, 28323023, 28324300, 28330770, 28332488, 28337542, 28352155, 28353032, 28369321, 28370471, 28370874, 28373279, 28373710, 28374838, 28378233, 28379951, 28386127, 28386933, 28387681, 28387683, 28395086, 28399184, 28400134, 28402459, 28409113, 28409245, 28411117, 28412655, 28413000, 28419945, 28419968, 28420950, 28424577, 28429355, 28431219, 28434076, 28439627, 28439961, 28442946, 28445713, 28450057, 28450268, 28451991, 28452474, 28454606, 28467708, 28469644, 28476637, 28477284, 28482862, 28487126, 28487947, 28495859, 28516276, 28520803, 28522732, 28526239, 28527958, 28528366, 28534083, 28538683, 28539529, 28550072, 28554408, 28554409, 28554411, 28562630, 28569795, 28571556, 28573674, 28576942, 28580639, 28582870, 28585223, 28585381, 28592304, 28604235, 28614652, 28614796, 28618343, 28619113, 28620826, 28621812, 28623611, 28624352, 28632413, 28636593, 28637871, 28642128, 28645308, 28647363, 28648742, 28650719, 28651250, 28656548, 28659169, 28667699, 28668282, 28671142, 28671665, 28673590, 28673834, 28676095, 28676755, 28686317, 28690195, 28695482, 28696167, 28696461, 28698628, 28706191, 28710275, 28711405, 28711409, 28713240, 28722658, 28724388, 28725967, 28731447, 28732710, 28734051, 28736195, 28741930, 28743955, 28755477, 28759722, 28764902, 28764908, 28776303, 28778441, 28780169, 28780180, 28781905, 28790319, 28790323, 28797124, 28800113, 28801354, 28802919, 28802920, 28803148, 28803412, 28805583, 28807729, 28808780, 28810585, 28811225, 28820063, 28820253, 28821274, 28824465, 28825895, 28827536, 28827786, 28829427, 28830306, 28833174, 28835999, 28841377, 28843014, 28843021, 28844730, 28847804, 28860381, 28863169, 28866688, 28872299, 28874699, 28875428, 28877262, 28880418, 28883016, 28883518, 28887769, 28900002, 28903492, 28903781, 28905919, 28911198, 28917824, 28918051, 28918943, 28920936, 28921554, 28923294, 28923922, 28927576, 28928732, 28931065, 28933786, 28934392, 28939194, 28941726, 28945746, 28957336, 28965745, 28965931, 28968082, 28972555, 28973645, 28980756, 28981090, 28985507, 28986122, 28986235, 28986288, 28987181, 28987463, 28988985, 28990084, 28992347, 28993630, 29021297, 29021298, 29021755, 29021837, 29024008, 29027056, 29030433, 29030452, 29035751, 29036344, 29039141, 29040593, 29045863, 29048372, 29052536, 29054095, 29054856, 29057912, 29064068, 29064079, 29066967, 29069955, 29078029, 29089438, 29100107, 29100525, 29107086, 29111367, 29116402, 29118344, 29119326, 29123078, 29124790, 29129675, 29130486, 29137975, 29137980, 29141588, 29149290, 29151169, 29154191, 29155051, 29162163, 29163149, 29166608, 29169728, 29172450, 29180135, 29180403, 29180624, 29184069, 29185072, 29189163, 29191831, 29196214, 29198021, 29200905, 29203207, 29214369, 29217686, 29223072, 29228971, 29229832, 29241654, 29242346, 29243911, 29246324, 29246724, 29246765, 29248340, 29249285, 29270108, 29270291, 29272304, 29273397, 29273501, 29274035, 29276384, 29279394, 29281030, 29286644, 29290548, 29292725, 29295991, 29298416, 29300342, 29301103, 29305061, 29305855, 29305919, 29307058, 29309590, 29310663, 29312137, 29313342, 29313531, 29326545, 29330884, 29341898, 29342421, 29352191, 29355568, 29360467, 29364143, 29364151, 29364516, 29366673, 29367610, 29370524, 29372732, 29375308, 29382725, 29383832, 29385658, 29396794, 29398121, 29400668, 29407413, 29408361, 29409704, 29411106, 29414102, 29414104, 29416594, 29417650, 29420861, 29422107, 29422109, 29429047, 29433982, 29451381, 29452354, 29466944, 29473513, 29473656, 29475564, 29478699, 29480231, 29480459, 29487216, 29489958, 29497361, 29500813, 29503608, 29505813, 29505953, 29513569, 29515354, 29524323, 29524634, 29526688, 29536165, 29539261, 29541535, 29544548, 29547959, 29549278, 29550546, 29550604, 29551576, 29551693, 29563864, 29565978, 29570693, 29570792, 29571767, 29572816, 29575453, 29577851, 29579237, 29589201, 29589283, 29592843, 29593491, 29594935, 29599149, 29600388, 29601177, 29601727, 29603451, 29604408, 29604467, 29608598, 29608844, 29615762, 29623065, 29624735, 29626444, 29627340, 29630637, 29632069, 29632314, 29633780, 29634982, 29636661, 29642031, 29649746, 29655942, 29662465, 29662651, 29669468, 29675576, 29676021, 29676481, 29678776, 29679389, 29680709, 29681024, 29681525, 29686602, 29688812, 29691802, 29700116, 29700982, 29702073, 29704492, 29705185, 29707965, 29712958, 29714132, 29716652, 29718367, 29722028, 29725038, 29725300, 29725687, 29730780, 29730891, 29735655, 29737566, 29738845, 29747217, 29747690, 29747823, 29750499, 29751824, 29755341, 29755356, 29759483, 29769405, 29770111, 29771508, 29780350, 29782835, 29785351, 29801501, 29803930, 29844450, 29848975, 29853639, 29855356, 29858057, 29859327, 29859873, 29863470, 29865270, 29866153, 29866443, 29867358, 29868450, 29869713, 29874605, 29886526, 29886528, 29888220, 29892158, 29894766, 29895861, 29896411, 29899409, 29906099, 29906669, 29907754, 29909971, 29913017, 29917054, 29923074, 29924502, 29924993, 29925018, 29926816, 29930495, 29934589, 29941606, 29941946, 29950985, 29951679, 29953201, 29959908, 29960040, 29961428, 29964084, 29969391, 29969861, 29974096, 29976670, 29976995, 29978862, 29983568, 29987762, 29988049, 29988147, 29988485, 29989488, 29991596, 29993134, 29995769, 29996045, 29996119, 30009467, 30010663, 30018113, 30019639, 30021006, 30025458, 30025892, 30030380, 30040713, 30041032, 30046897, 30059366, 30065316, 30067901, 30077783, 30080657, 30081046, 30083953, 30089615, 30092270, 30092810, 30093536, 30097997, 30098984, 30099122, 30099890, 30102984, 30106035, 30107856, 30120622, 30125936, 30127453, 30127535, 30127714, 30127724, 30132200, 30137426, 30142705, 30142878, 30146727, 30150626, 30152864, 30165873, 30172844, 30183251, 30184304, 30194957, 30197194, 30200997, 30201422, 30213230, 30216674, 30218400, 30218757, 30219847, 30221226, 30222521, 30225556, 30233303, 30233304, 30236861, 30245141, 30248065, 30249394, 30249646, 30249789, 30249792, 30250173, 30251672, 30252534, 30253092, 30254002, 30258347, 30260559, 30262379, 30264465, 30266652, 30267336, 30269383, 30277516, 30277753, 30278239, 30279468, 30284665, 30287222, 30288631, 30288644, 30290273, 30297212, 30305312, 30308173, 30310174, 30311974, 30315896, 30316070, 30316984, 30319334, 30320583, 30324423, 30328509, 30329047, 30333786, 30333787, 30334187, 30336223, 30336481, 30341610, 30342273, 30346044, 30349448, 30352158, 30356861, 30357936, 30359694, 30362073, 30366065, 30369868, 30370500, 30371053, 30380895, 30381260, 30381408, 30384594, 30385548, 30385782, 30388770, 30394624, 30404828, 30410434, 30411062, 30419450, 30422655, 30423195, 30424585, 30424941, 30426321, 30427511, 30450079, 30457584, 30459551, 30462117, 30465671, 30466800, 30471223, 30474172, 30478174, 30480033, 30481547, 30481588, 30482039, 30483063, 30485547, 30485814, 30496735, 30503521, 30506233, 30509033, 30509990, 30510219, 30514850, 30517862, 30524265, 30524354, 30527540, 30528127, 30528390, 30530257, 30530923, 30536063, 30536337, 30551452, 30552719, 30554085, 30557654, 30562735, 30564614, 30569287, 30572013, 30579934, 30579996, 30589944, 30591215, 30591714, 30598082, 30601948, 30609391, 30610666, 30618632, 30619053, 30620180, 30620687, 30622456, 30625272, 30628768, 30633814, 30635607, 30637520, 30637614, 30639209, 30639210, 30639428, 30641037, 30650656, 30651314, 30654525, 30655291, 30658140, 30658149, 30665447, 30671473, 30676715, 30682886, 30686993, 30689867, 30690184, 30690664, 30692508, 30692923, 30694039, 30706414, 30708997, 30711526, 30712480, 30714719, 30715632, 30717266, 30718039, 30721408, 30728466, 30731136, 30738426, 30738909, 30740124, 30741689, 30741691, 30745444, 30745863, 30753527, 30755483, 30759377, 30760864, 30761004, 30761145, 30769283, 30771165, 30771169, 30771172, 30771176, 30771177, 30771184, 30771185, 30776494, 30783136, 30785257, 30787269, 30788890, 30791479, 30796010, 30796849, 30796974, 30797969, 30801763, 30802532, 30805666, 30805957, 30808409, 30810027, 30814575, 30826264, 30837941, 30840785, 30849508, 30853581, 30858851, 30862106, 30862700, 30866550, 30867902, 30871620, 30877431, 30877973, 30878283, 30878495, 30890737, 30900456, 30902527, 30904670, 30905782, 30917651, 30917654, 30925741, 30926586, 30927072, 30927362, 30930168, 30932894, 30933517, 30943367, 30946930, 30949020, 30949044, 30954607, 30958793, 30964656, 30968030, 30976973, 30978965, 30981640, 30982161, 30983487, 30985105, 30985756, 30987677, 30989481, 30995486, 31004503, 31009074, 31022302, 31023342, 31027150, 31029796, 31031582, 31031694, 31033038, 31036561, 31041581, 31041582, 31048377, 31050886, 31051162, 31055236, 31056668, 31057362, 31059019, 31068782, 31069800, 31070198, 31078683, 31079293, 31083520, 31085616, 31092553, 31096048, 31096049, 31097622, 31102707, 31102760, 31105524, 31105527, 31110191, 31111370, 31117342, 31123587, 31125602, 31129265, 31132469, 31133790, 31134068, 31136763, 31139367, 31140178, 31142553, 31147655, 31148150, 31153750, 31165254, 31165472, 31165943, 31167929, 31168644, 31170426, 31173779, 31175983, 31178336, 31180515, 31180611, 31181290, 31182727, 31185031, 31185338, 31186026, 31186086, 31190374, 31191239, 31196755, 31201929, 31202707, 31203580, 31204315, 31207024, 31208386, 31209363, 31209785, 31211448, 31211781, 31211923, 31214110, 31214163, 31221716, 31223479, 31226488, 31226647, 31227656, 31229470, 31230104, 31233777, 31234232, 31234238, 31235589, 31237944, 31240402, 31242217, 31243602, 31244600, 31251339, 31252669, 31254094, 31255487, 31258461, 31265130, 31265132, 31267130, 31269263, 31270237, 31276729, 31276792, 31277379, 31295458, 31302715, 31305509, 31312839, 31313223, 31314610, 31322768, 31324556, 31325583, 31327219, 31327496, 31331359, 31333408, 31338105, 31340844, 31343083, 31349736, 31349930, 31349931, 31356747, 31361367, 31369243, 31370680, 31375560, 31378574, 31379027, 31380806, 31385687, 31388087, 31388798, 31401305, 31401695, 31402119, 31404721, 31405930, 31406572, 31410011, 31416122, 31419995, 31420910, 31422098, 31424187, 31426448, 31427526, 31428316, 31434803, 31437653, 31440136, 31441047, 31443765, 31445162, 31447645, 31447651, 31447665, 31456205, 31459084, 31459612, 31469130, 31476446, 31477175, 31477241, 31481162, 31485291, 31488222, 31504212, 31504665, 31507364, 31508228, 31514384, 31520492, 31521608, 31522685, 31535203, 31538320, 31547305, 31547734, 31548371, 31551921, 31553333, 31555122, 31560998, 31566224, 31571649, 31572186, 31572723, 31576631, 31580415, 31586134, 31586624, 31587020, 31591837, 31594249, 31600047, 31600778, 31601400, 31602625, 31603207, 31603909, 31609697, 31609699, 31609701, 31611767, 31616427, 31621602, 31621624, 31623323, 31625739, 31627816, 31632270, 31634558, 31635805, 31640762, 31643079, 31643109, 31644913, 31648898, 31649329, 31649506, 31654699, 31661838, 31666195, 31670439, 31683259, 31685606, 31685848, 31686426, 31689937, 31692132, 31695184, 31697492, 31698188, 31698547, 31699323, 31699325, 31699336, 31704453, 31705886, 31707034, 31713092, 31719530, 31721123, 31721560, 31724509, 31727879, 31728738, 31732967, 31733655, 31734439, 31740740, 31742923, 31744532, 31744850, 31748376, 31749671, 31749672, 31753312, 31758049, 31758091, 31758346, 31759083, 31760107, 31760463, 31761041, 31761523, 31765822, 31768670, 31769073, 31772376, 31773362, 31775051, 31783082, 31785806, 31792467, 31796095, 31796099, 31797870, 31799519, 31800144, 31802003, 31804560, 31807952, 31809571, 31809698, 31812666, 31815671, 31816026, 31820696, 31827096, 31830361, 31834548, 31835741, 31836471, 31837422, 31837423, 31837424, 31847878, 31848207, 9197268, 9300660, 9389595, 9443491, 9484385, 9506559, 9566408, 9601701, 9628579, 9634534, 9708553, 9737786, 9743579, 9749575, 9776460, 9793932, 9808333, 9809770, 9811326, 9811617, 9855543, 9857974, 9862427, 9862428, 9865795, 9875730		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	10075647, 10092675, 10391881, 10407019, 10557341, 10619569, 10639120, 10766891, 10818098, 10915790, 10934254, 10952980, 11080208, 11181819, 11309462, 11331421, 11438481, 11560921, 11590151, 11593272, 11734199, 11744721, 11812782, 11893734, 12058349, 12145295, 12213717, 12239163, 12551928, 12661766, 12684441, 12716427, 12867415, 12893833, 12900507, 14535945, 14756800, 15026413, 15028717, 15502874, 15672325, 15718234, 15817478, 15944382, 16020550, 16166095, 16174773, 16320253, 16495229, 16567160, 16606366, 16678164, 16847063, 16957079, 17189270, 17200685, 17381514, 17391701, 17412603, 17448146, 17451452, 17531291, 17556099, 17573347, 17712623, 17785456, 17893145, 17900533, 17971075, 17987278, 18070888, 18211709, 18245082, 18252210, 18258594, 18297293, 18322396, 18346205, 18382667, 18389263, 18414880, 18436529, 18436957, 18440504, 18505736, 18571778, 18573343, 18601999, 18692132, 18772193, 18848547, 18852892, 18957893, 18985386, 19006185, 19013262, 19027885, 19049426, 19126542, 19141614, 19164286, 19164293, 19196539, 19205068, 19242547, 19328772, 19345692, 19409963, 19412953, 19476547, 19540308, 19558452, 19596443, 19632874, 19722699, 19834617, 19860837, 19915575, 20026050, 20026206, 20041693, 20070850, 20074637, 20127702, 20132485, 20141569, 20152107, 20334701, 20433710, 20445061, 20448034, 20463956, 20599975, 20604806, 20624440, 20664293, 20683486, 20697102, 20733075, 20890676, 20947801, 20972807, 21044948, 21046180, 21056999, 21060011, 21091474, 21127069, 21237164, 21248740, 21264917, 21330368, 21338068, 21412835, 21425343, 21448452, 21491910, 21520980, 21613474, 21653695, 21689433, 21718702, 21757228, 21767974, 21795716, 21812969, 21816655, 21829596, 21848810, 21863007, 21907175, 21951066, 21953863, 22003392, 22023810, 22031823, 22065755, 22067166, 22104010, 22119730, 22178859, 22182687, 22275250, 22326202, 22334684, 22404520, 22426833, 22453917, 22457822, 22615757, 22617348, 22623900, 22701727, 22757585, 22757587, 22776646, 22786590, 22848108, 22848530, 22912757, 22920859, 22927976, 22988096, 23022913, 23028833, 23071545, 23266198, 23284971, 23300640, 23308173, 23349712, 23374074, 23389286, 23404372, 23427326, 23492776, 23505409, 23507417, 23576548, 23594135, 23603399, 23607785, 23710708, 23736218, 23747310, 23861789, 23916651, 23921388, 23934919, 23939307, 23939407, 23962496, 23984410, 24003031, 24005725, 24043770, 24066883, 24070323, 24120997, 24121126, 24138030, 24148766, 24152121, 24173167, 24204929, 24290359, 24434619, 24436092, 24578302, 24593806, 24656894, 24728187, 24742361, 24742669, 24752924, 24777780, 24831002, 24838182, 24892822, 24935484, 24984882, 24989254, 25003242, 25054189, 25099483, 25125346, 25175702, 25178429, 25207598, 25212463, 25220617, 25231978, 25310737, 25370538, 25390032, 25393002, 25429104, 25434005, 25460623, 25505181, 25541488, 25600808, 25617759, 25635052, 25637461, 25742170, 25790376, 25886189, 25960998, 25985292, 26068055, 26083886, 26208350, 26214314, 26245297, 26274610, 26306801, 26317803, 26405178, 26448324, 26453205, 26465922, 26497684, 26509433, 26539989, 26582456, 26601739, 26610207, 26621506, 26644467, 26653056, 26793951, 26919570, 27080380, 27091628, 27094865, 27096366, 27123591, 27191603, 27226637, 27288043, 27299523, 27332068, 27335051, 27385586, 27413154, 27445146, 27573854, 27591066, 27613114, 27743341, 27798653, 27866262, 27888296, 27938414, 28057070, 28075555, 28108469, 28131822, 28164279, 28214539, 28230073, 28232489, 28282812, 28300069, 28373279, 28374838, 28383562, 28387681, 28399184, 28416701, 28429355, 28431219, 28450057, 28452474, 28487126, 28487947, 28582870, 28624352, 28636593, 28651250, 28698628, 28710275, 28731447, 28827786, 28866688, 28877262, 28883518, 28917824, 28972555, 28973645, 28985507, 28986288, 28988985, 28990084, 29052536, 29054856, 29057912, 29149290, 29242346, 29243911, 29364143, 29398121, 29420861, 29466944, 29500813, 29603451, 29614969, 29725038, 29730780, 29738845, 29750859, 29849887, 29853639, 29868450, 29899557, 29906669, 29917054, 29953413, 29969391, 29991596, 29995769, 30021006, 30107856, 30146727, 30266652, 30304516, 30320583, 30342273, 30352158, 30372687, 30400105, 30472757, 30562735, 30598082, 30639209, 30655561, 30738426, 30753527, 30769283, 30788890, 30801763, 30805666, 30926586, 30957308, 30985756, 31048377, 31097622, 31134068, 31136022, 31180515, 31211166, 31211448, 31229470, 31234232, 31261387, 31270237, 31295458, 31361367, 31422003, 31424918, 31441047, 31501480, 31547305, 31633065, 31634558, 31695184, 31719530, 31727879, 31733655, 31760463, 31769073, 31804465, 31804560, 31815671, 31847878, 31870437, 31915018, 31937832, 31954327, 31976583, 31991248, 32002988, 32015135, 32025699, 32035284, 32139796, 32144674, 32160287, 32170541, 32176655, 32240735, 32291284, 32299492, 32359427, 32375873, 32413791, 32415621, 32429337, 32432761, 32444558, 32453478, 32457390, 32486284, 32486485, 32573439, 32641146, 32707907, 32709107, 32733076, 32753661, 32794578, 32798915, 32800998, 32868414, 32869336, 32921251, 32927687, 32949572, 32954426, 33003328, 33032646, 33046546, 33066427, 33082300, 33110167, 33173039, 33213513, 33232556, 33272323, 33301617, 33307186, 33342090, 33428332, 33432042, 33450872, 33470460, 33527742, 33539026, 33597231, 33637132, 33649398, 33652595, 33657088, 33672321, 33771571, 33798554, 33809978, 33832546, 33900085, 33947435, 33979611, 33983072, 34076298, 34115198, 34155194, 34175689, 34204164, 34213307, 34215448, 34227697, 34229155, 34234930, 34254125, 34288055, 34321086, 34334418, 34381149, 34439733, 34448525, 34464855, 34520759, 34572052, 34613701, 34625559, 34674795, 34685771, 34696975, 34717775, 34742348, 34754035, 34799977, 34882862, 34944443, 34946922, 34948195, 34983390, 35023548, 35026420, 35040589, 35049152, 35068417, 35091253, 35106798, 35141810, 35145226, 35163733, 35166042, 35179198, 35189566, 35213388, 35263701, 35264710, 35286755, 35289213, 35294277, 35314196, 35328814, 35328997, 35346107, 35397003, 35418463, 35421944, 35454081, 35474118, 35482760, 35486726, 35551349, 35567546, 35580766, 35613323, 35648061, 35688132, 35762714, 35805172, 35866299, 35894540, 35917738, 35978378, 35981040, 36001084, 36076304, 36099961, 36130205, 36130498, 36174040, 36208776, 36208865, 36261424, 36262874, 36297052, 36351406, 36371251, 36376318, 36380732, 36417521, 36423813, 36430645, 36454869, 36455858, 36464107, 36499697, 36626307, 36674945, 36690898, 36692014, 36737438, 36750613, 36751943, 36752535, 36768321, 36769009, 36795141, 36831291, 36858582, 36871760, 36906636, 36939875, 36976861, 37047286, 37059509, 37080960, 37107677, 37113744, 37178741, 37229975, 37238596, 37238734, 37247383, 37252975, 37271312, 37286800, 37290280, 37309980, 37336145, 37358478, 37365181, 37406134, 37408202, 37479568, 37536279, 37549799, 37586882, 37596531, 37686360, 37731009, 37759704, 37803093, 37853101, 37898823, 37919529, 37947401, 37981592, 37996943, 38011719, 38048087, 38062843, 38069536, 38105619, 38145277, 38154385, 38189631, 38245794, 38366711, 38429622, 38511533, 38599826, 39218026, 39222576, 39273169, 39383232, 39511366, 39587654, 39617169, 39684444, 39695344, 39756734, 39766295, 39863324, 39938327, 39957201, 40001517, 40015617, 40019135, 40176604, 40216992, 40238878, 40317721, 40453094, 40479844, 40522183, 40617169, 40702763, 40724923, 9546347, 9628579, 9634534, 9801138, 9806846, 9811326, 9862427, 9862428	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	CTD_human_DG	11535288, 12151787, 12732244, 12885775, 14535945, 15099020, 17131421, 17690948, 18322262, 18353766, 18841091, 19915575, 19915576, 20664293, 20711177, 21245015, 21892157, 22043175, 22110584, 22166454, 22185909, 22355530, 24509835, 24833599, 25064009, 25106480, 25149416, 25475535, 25631236		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	LHGDN	11814343, 11823645, 12025860, 12042811, 12115139, 12138709, 12367530, 12428717, 12428728, 12493604, 12576551, 12784265, 14593171, 14692700, 14987449, 15109581, 15282274, 15289452, 15300629, 15304594, 15338643, 15364911, 15671169, 15672325, 15717024, 15817478, 15917102, 15955578, 15976091, 16166095, 16250025, 16358335, 16780837, 16794039, 16930553, 16959795, 17049244, 17077307, 17166628, 17309880, 17373725, 17489854, 17531291, 17625105, 17683088, 17708336, 17872362, 18018486, 18036154, 18178617, 18179253, 18195271, 18210157, 18322262, 18322396, 18390556, 18404644, 18463503, 18568448, 18622040, 18625222, 18702696, 18708765, 18751989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	17203291, 22019052, 25849645, 26220939, 27021906, 32006615, 34067663, 34285331, 35175558	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	GWASDB_DG	19915575, 19915576, 20070850, 20711177, 21044948, 21084426, 21292315, 21738487, 22438815, 22451204, 24511991		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	GWASCAT_DG	19915575, 19915576, 20070850, 20711177, 21044948, 21084426, 21292315, 21738487, 22438815, 22451204, 24511991, 25064009, 27182965, 28011712, 28892059, 30957308		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	24477431, 32879386, 35044538, 35362022, 36677744, 36982820, 39684585	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE 1, AUTOSOMAL DOMINANT (disorder)	Parkinson disease	UNIPROT_DG	14755719, 23427326, 23457019, 24936070, 25561023, 9197268, 9462735		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 1, AUTOSOMAL DOMINANT (disorder)	Parkinson disease	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 1, AUTOSOMAL DOMINANT (disorder)	Parkinson disease	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 1, AUTOSOMAL DOMINANT (disorder)	Parkinson disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 15, AUTOSOMAL RECESSIVE (disorder)	Parkinson disease	BEFREE	23526723		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 15, AUTOSOMAL RECESSIVE (disorder)	Parkinson disease	ORPHANET_DG	23526723		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	BEFREE	15326242, 15663960		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 2, AUTOSOMAL RECESSIVE JUVENILE	Parkinson Disease	CTD_human_DG	20464527, 22319455, 23046578, 23295396, 26075822, 26558463, 26687234, 27026137, 27324791		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 4, AUTOSOMAL DOMINANT LEWY BODY (disorder)	Parkinson disease	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 4, AUTOSOMAL DOMINANT LEWY BODY (disorder)	Parkinson disease	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Parkinson Disease 6, Autosomal Recessive Early-Onset	Parkinson disease	BEFREE	29166608, 31277379		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE 7, AUTOSOMAL RECESSIVE EARLY-ONSET	Parkinson disease	BEFREE	15717024		★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	15026413, 16020550, 17291816, 18571778, 20127702, 21653695, 21757228, 21953863, 23934919, 24892822, 25003242, 26077166, 26306801, 27091628, 27096366, 27352802, 27591066, 27613114, 28131822, 31229470, 32015135, 32291284, 34768981, 35286755, 35362022, 35997131, 36261424, 38145277, 9728955	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease Secondary	Secondary parkinson disease	Pubtator	27413154	Stimulate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	12752402, 15622440, 15719423, 19586054, 23626796, 23936403, 26247888, 27191603, 27262440, 27335051, 27546826, 27965467, 28117497, 28126589, 28233934, 28298083, 28522732, 28568905, 29027056, 29436735, 29702073, 29780350, 30067901, 30348495, 30637520, 30728466, 30738909, 31079293, 31102707, 31240402, 31270237, 31697492, 31727879, 31749672, 31758740		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	10482268, 10599788, 10963357, 11037196, 11261505, 11442360, 11455179, 12378057, 12489918, 12732244, 12846986, 12940846, 14698476, 14736756, 14755720, 15009131, 15033141, 15144854, 15451224, 15455441, 16001411, 16020550, 16358335, 16406842, 17000465, 17077307, 17251522, 17291816, 17388981, 17531291, 17620882, 17625105, 17761553, 18366718, 18413475, 18571778, 18625222, 18787878, 18824390, 19139307, 19369384, 19562770, 19576930, 19833540, 19864570, 19890971, 19915576, 20200163, 20411780, 20430055, 20445061, 20493840, 20818659, 21333719, 21761143, 21800132, 21995845, 22014436, 22617348, 23254192, 23457019, 23664753, 23812893, 23934919, 24068758, 24656894, 24746362, 24773432, 25003242, 25149416, 25554495, 26077166, 26306801, 26324905, 26350119, 26880146, 27091628, 27413154, 27613114, 28297586, 28324300, 28476636, 28673739, 28880418, 28910367, 28986288, 29024008, 29111028, 29124790, 29198021, 29233723, 29248340, 29310663, 29422109, 29737566, 29755341, 30113007, 30333786, 30423204, 30584155, 30605594, 30619023, 30706414, 30801759, 31385584, 31406572, 31732923, 9500549, 9566408, 9878203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson disease	Pubtator	17531291, 18366718, 20445061, 22617348, 22623900, 24656894, 27091628	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	LHGDN	18413475, 18571778, 18852445		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	CTD_human_DG	20464527, 22319455, 23046578, 23295396, 26075822, 26558463, 26687234, 27026137, 27324791		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian Disorders	Parkinson Disease	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonian-pyramidal syndrome	Parkinsonian-Pyramidal Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinsonism, Juvenile	Parkinsonian disease	CTD_human_DG	20464527, 22319455, 23046578, 23295396, 26075822, 26558463, 26687234, 27026137, 27324791		★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	BEFREE	31031694, 31621602		★☆☆☆☆ Found in Text Mining only
Perry Syndrome	Perry Syndrome	BEFREE	30215870		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	28181068		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	24269733, 28132806, 28810585		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	11260802, 11377973, 25003242, 26306801, 28012952, 9811617		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	38256230	Inhibit	★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	25594371		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	10809401, 11708989, 12489918, 12883830, 15172093, 15451224, 15622440, 15655259, 16358335, 16947080, 17251522, 17683088, 17918232, 18335262, 18413475, 18451726, 18571778, 19006185, 19021752, 19562770, 19735092, 19833540, 19864570, 21596773, 21734300, 22013209, 22269890, 22508839, 23254192, 23457019, 24936070, 25450466, 26350119, 27091628, 27283588, 27979356, 28269775, 28419566, 28476636, 28550528, 28582864, 28645308, 28870518, 28910367, 28987181, 29233723, 29843245, 29869713, 29933008, 30083953, 30249789, 30324423, 30423201, 30619023, 30635607, 31102707, 31424413, 9811326		★☆☆☆☆ Found in Text Mining only
Prion Diseases	Prion disease	Pubtator	22701727, 27793473, 35288744	Associate	★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	10923991, 11134398, 11935271, 26506339, 28843020, 29878075, 30324423, 30796010, 31406572, 9443491		★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy atypical	Progressive supranuclear palsy	Pubtator	17675576, 27091628	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	25053345, 31289580		★☆☆☆☆ Found in Text Mining only
Psychomotor Agitation	Psychiatric disorders	Pubtator	12684441	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32559455	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30315241		★☆☆☆☆ Found in Text Mining only
Ramsay Hunt Paralysis Syndrome	Ramsay Hunt Paralysis Syndrome	CTD_human_DG	20464527, 22319455, 23046578, 23295396, 26075822, 26558463, 26687234, 27026137, 27324791		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27491898, 28807336		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	24863655, 29033051, 31004074		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	30099122		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	38429622	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	15022318, 28791012		★☆☆☆☆ Found in Text Mining only
Rosacea	Rosacea	Pubtator	37437773	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	27564547		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	28688724, 29220291		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	28539953, 31410011		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	32432761	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	31788079		★☆☆☆☆ Found in Text Mining only
Secondary Parkinson Disease	Parkinson disease	BEFREE	18061619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	14535945, 39256877	Associate	★☆☆☆☆ Found in Text Mining only
Senile cardiac amyloidosis	Senile Cardiac Amyloidosis	BEFREE	22591216		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	10491577, 10704204, 16947080, 16951579, 19744960, 22460692, 29111606, 30366065		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	29049359, 29345058		★☆☆☆☆ Found in Text Mining only
Shy-Drager Syndrome	Shy-Drager Syndrome	BEFREE	20493840		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	35325812	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	24728187	Stimulate	★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	24728187, 28698628	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	BEFREE	23938351, 29072553, 31471503		★☆☆☆☆ Found in Text Mining only
Sleep Disorders	Sleep Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29776963		★☆☆☆☆ Found in Text Mining only
Small Fiber Neuropathy	Small Fiber Neuropathy	BEFREE	31178336, 31305509		★☆☆☆☆ Found in Text Mining only
Social Communication Disorder	Social Communication Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	26306801, 26506339	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	26506339		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	20640532, 28362802		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35923111	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	29355614, 29548299, 31562203		★☆☆☆☆ Found in Text Mining only
Striatonigral Degeneration	Striatonigral Degeneration	BEFREE	14502650, 22161470		★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	17675576, 26506339	Associate	★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	26999333		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	29143824		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	22274654		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	15033141, 16609851, 19369384, 21453448, 21787314, 27629562, 28363800, 28992347, 29246723, 29878075, 30018327, 30107539, 31105524		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	LHGDN	16609851, 17675576		★☆☆☆☆ Found in Text Mining only
Thymic Carcinoma	Thymic Carcinoma	BEFREE	31639039		★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	27021906	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29336717		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	30503177		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	35346107	Inhibit	★☆☆☆☆ Found in Text Mining only
Varicosity	Vulval varices	BEFREE	12946025, 23703938, 28416701, 31705886		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	22274654		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation	Ventricular fibrillation	Pubtator	12900507, 18692132, 19013262, 19596443, 28624352, 32291284	Associate	★☆☆☆☆ Found in Text Mining only
Young onset Parkinson disease	Parkinson disease	BEFREE	10348463, 10555832, 10639120, 11032911, 11560511, 11806835, 12367530, 12402251, 15622440, 17251522, 18973254, 19205068, 21718702, 23404372, 23938351, 25909158, 27455133, 28361483, 28830306, 30116778, 30755581, 30892349, 30914006, 9389595, 9809558		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Young-onset Parkinson disease	Parkinson disease	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations