Gene Gene information from NCBI Gene database.
Entrez ID 6619
Gene name Small nuclear RNA activating complex polypeptide 3
Gene symbol SNAPC3
Synonyms (NCBI Gene)
PTFbetaSNAP50
Chromosome 9
Chromosome location 9p22.3
miRNA miRNA information provided by mirtarbase database.
517
miRTarBase ID miRNA Experiments Reference
MIRT610214 hsa-miR-29b-2-5p HITS-CLIP 19536157
MIRT610213 hsa-miR-670-3p HITS-CLIP 19536157
MIRT610212 hsa-miR-1238-3p HITS-CLIP 19536157
MIRT610211 hsa-miR-659-3p HITS-CLIP 19536157
MIRT610214 hsa-miR-29b-2-5p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
20
GO ID Ontology Definition Evidence Reference
GO:0000978 Function RNA polymerase II cis-regulatory region sequence-specific DNA binding IBA
GO:0000995 Function RNA polymerase III general transcription initiation factor activity NAS 7715707
GO:0001006 Function RNA polymerase III type 3 promoter sequence-specific DNA binding IBA
GO:0001046 Function Core promoter sequence-specific DNA binding IBA
GO:0003677 Function DNA binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
602348 11136 ENSG00000164975
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92966
Protein name snRNA-activating protein complex subunit 3 (SNAPc subunit 3) (Proximal sequence element-binding transcription factor subunit beta) (PSE-binding factor subunit beta) (PTF subunit beta) (Small nuclear RNA-activating complex polypeptide 3) (snRNA-activating
Protein function Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TB
PDB 7XUR , 7ZWC , 7ZWD , 7ZX7 , 7ZX8 , 7ZXE , 8ITY , 8IUE , 8IUH , 9FSO , 9FSP , 9FSQ , 9FSR , 9FSS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12251 zf-SNAP50_C 202 405 snRNA-activating protein of 50kDa MW C terminal Family
Sequence
MAEGSRGGPTCSGVGGRQDPVSGSGGCNFPEYELPELNTRAFHVGAFGELWRGRLRGAGD
LSLREPPASALPGSQAADSDREDAAVARDLDCSLEAAAELRAVCGLDKLKCLEDGEDPEV
IPENTDLVTLGVRKRFLEHREETITIDRACRQETFVYEMESHAIGKKPENSADMIEEGEL
ILSVNILYPVIFHKHKEHKPYQTMLVLGSQKLTQLRDSIRCVSDLQIGGEFSNTPDQAPE
HISKDLYKSAFFYFEGTFYNDKRYPECRDLSRTIIEWSESHDRGYGKFQTARMEDFTFND
LCIKLGFPYLYCHQGDCEHVIVITDIRLVHHDDCLDRTLYPLLIKKHWLWTRKCFVCKMY
TARWVTNNDSFAPEDPCFFCDVCFRMLHYDSEGNKLGEFLAYPYV
DPGTFN
Sequence length 411
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    RNA polymerase II transcribes snRNA genes
RNA Polymerase III Transcription Initiation From Type 3 Promoter
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SCHIZOPHRENIA GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Osteosarcoma Osteosarcoma Pubtator 34922489 Associate
★☆☆☆☆
Found in Text Mining only