Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6618
Gene name	Small nuclear RNA activating complex polypeptide 2
Gene symbol	SNAPC2
Synonyms (NCBI Gene)	PTFDELTASNAP45
Chromosome	19
Chromosome location	19p13.2
Summary	This gene encodes a subunit of the snRNA-activating protein complex which is associated with the TATA box-binding protein. The encoded protein is necessary for RNA polymerase II and III dependent small-nuclear RNA gene transcription. Alternative splicing

Show/Hide all (50)

miRTarBase ID	miRNA	Experiments
MIRT1375196	hsa-miR-124	CLIP-seq
MIRT1375197	hsa-miR-128	CLIP-seq
MIRT1375198	hsa-miR-2110	CLIP-seq
MIRT1375199	hsa-miR-3144-5p	CLIP-seq
MIRT1375200	hsa-miR-3150a-3p	CLIP-seq
MIRT1375201	hsa-miR-3151	CLIP-seq
MIRT1375202	hsa-miR-3177-5p	CLIP-seq
MIRT1375203	hsa-miR-3179	CLIP-seq
MIRT1375204	hsa-miR-3191	CLIP-seq
MIRT1375205	hsa-miR-3199	CLIP-seq
MIRT1375206	hsa-miR-3202	CLIP-seq
MIRT1375207	hsa-miR-34a	CLIP-seq
MIRT1375208	hsa-miR-34c-5p	CLIP-seq
MIRT1375209	hsa-miR-4283	CLIP-seq
MIRT1375210	hsa-miR-4476	CLIP-seq
MIRT1375211	hsa-miR-4489	CLIP-seq
MIRT1375212	hsa-miR-449a	CLIP-seq
MIRT1375213	hsa-miR-449b	CLIP-seq
MIRT1375214	hsa-miR-4512	CLIP-seq
MIRT1375215	hsa-miR-4515	CLIP-seq
MIRT1375216	hsa-miR-4652-5p	CLIP-seq
MIRT1375217	hsa-miR-4668-5p	CLIP-seq
MIRT1375218	hsa-miR-4700-3p	CLIP-seq
MIRT1375219	hsa-miR-4716-3p	CLIP-seq
MIRT1375220	hsa-miR-4737	CLIP-seq
MIRT1375221	hsa-miR-506	CLIP-seq
MIRT1375222	hsa-miR-541	CLIP-seq
MIRT1375223	hsa-miR-625	CLIP-seq
MIRT1375224	hsa-miR-654-5p	CLIP-seq
MIRT1375196	hsa-miR-124	CLIP-seq
MIRT1375197	hsa-miR-128	CLIP-seq
MIRT1375221	hsa-miR-506	CLIP-seq
MIRT2334759	hsa-miR-214	CLIP-seq
MIRT2334760	hsa-miR-223	CLIP-seq
MIRT2334761	hsa-miR-3619-5p	CLIP-seq
MIRT2334762	hsa-miR-3661	CLIP-seq
MIRT2334763	hsa-miR-4270	CLIP-seq
MIRT2334764	hsa-miR-4441	CLIP-seq
MIRT2334765	hsa-miR-4663	CLIP-seq
MIRT2334766	hsa-miR-4758-3p	CLIP-seq
MIRT2334767	hsa-miR-631	CLIP-seq
MIRT2334768	hsa-miR-761	CLIP-seq
MIRT2334769	hsa-miR-885-3p	CLIP-seq
MIRT2394909	hsa-miR-361-3p	CLIP-seq
MIRT2460095	hsa-miR-3194-5p	CLIP-seq
MIRT2460096	hsa-miR-3918	CLIP-seq
MIRT2460097	hsa-miR-4468	CLIP-seq
MIRT2460098	hsa-miR-4640-5p	CLIP-seq
MIRT2460099	hsa-miR-4685-5p	CLIP-seq
MIRT2460100	hsa-miR-4726-5p	CLIP-seq

Show/Hide all (13)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7715707
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006366	Process	Transcription by RNA polymerase II	TAS	8524284
GO:0006383	Process	Transcription by RNA polymerase III	TAS	8524284
GO:0009301	Process	SnRNA transcription	IEA
GO:0009301	Process	SnRNA transcription	TAS	8524284
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IEA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	NAS	7715707
GO:0016604	Component	Nuclear body	IBA
GO:0016604	Component	Nuclear body	IDA

MIM	HGNC	e!Ensembl
605076	11135	ENSG00000104976

Q13487

Protein name

snRNA-activating protein complex subunit 2 (SNAPc subunit 2) (Proximal sequence element-binding transcription factor subunit delta) (PSE-binding factor subunit delta) (PTF subunit delta) (Small nuclear RNA-activating complex polypeptide 2) (snRNA-activati

Protein function

Part of the SNAPc complex required for the transcription of both RNA polymerase II and III small-nuclear RNA genes. Binds to the proximal sequence element (PSE), a non-TATA-box basal promoter element common to these 2 types of genes. Recruits TB

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF11035	SnAPC_2_like	1 → 331	Small nuclear RNA activating complex subunit 2, SNAP190 Myb	Family

Sequence

MKPPPRRRAAPARYLGEVTGPATWSAREKRQLVRLLQARQGQPEPDATELARELRGRSEA
EIRVFLQQLKGRVAREAIQKVHPGGLQGPRRREAQPPAPIEVWTDLAEKITGPLEEALAV
AFSQVLTIAATEPVTLLHSKPPKPTQARGKPLLLSAPGGQEDPAPEIPSSAPAAPSSAPR
TPDPAPEKPSESSAGPSTEEDFAVDFEKIYKYLSSVSRSGRSPELSAAESAVVLDLLMSL
PEELPLLPCTALVEHMTETYLRLTAPQPIPAGGSLGPAAEGDGAGSKAPEETPPATEKAE
HSELKSPWQAAGICPLNPFLVPLELLGRAATPAR

Sequence length

334

Interactions

View interactions

	Reactome
			RNA polymerase II transcribes snRNA genes RNA Polymerase III Transcription Initiation From Type 3 Promoter

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	40465781	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26506879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26506879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26506879		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	BEFREE	27610895		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	27610895		★★★★★ ★☆☆☆☆ Found in Text Mining only

SNAPC2 (small nuclear RNA activating complex polypeptide 2)