SIGLEC1 (sialic acid binding Ig like lectin 1)

Gene

• Entrez ID: 6614
• Gene name: Sialic acid binding Ig like lectin 1
• Gene symbol: SIGLEC1
• Synonyms (NCBI Gene): CD169, SIGLEC-1, SN
• Chromosome: 20
• Chromosome location: 20p13
• Summary: This gene encodes a member of the immunoglobulin superfamily. The encoded protein is a lectin-like adhesion molecule that binds glycoconjugate ligands on cell surfaces in a sialic acid-dependent manner. It is a type I transmembrane protein expressed only

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1348526	hsa-miR-1913	CLIP-seq
MIRT1348527	hsa-miR-3148	CLIP-seq
MIRT1348528	hsa-miR-3174	CLIP-seq
MIRT1348529	hsa-miR-324-3p	CLIP-seq
MIRT1348530	hsa-miR-346	CLIP-seq
MIRT1348531	hsa-miR-4288	CLIP-seq
MIRT1348532	hsa-miR-4481	CLIP-seq
MIRT1348533	hsa-miR-4711-3p	CLIP-seq
MIRT1348534	hsa-miR-4728-3p	CLIP-seq
MIRT1348535	hsa-miR-4745-5p	CLIP-seq
MIRT1348536	hsa-miR-4747-5p	CLIP-seq
MIRT1348537	hsa-miR-4758-5p	CLIP-seq
MIRT1348538	hsa-miR-549	CLIP-seq
MIRT1348539	hsa-miR-628-5p	CLIP-seq
MIRT1348540	hsa-miR-632	CLIP-seq
MIRT2103328	hsa-miR-1304	CLIP-seq
MIRT2103329	hsa-miR-3121-5p	CLIP-seq
MIRT2103330	hsa-miR-3126-5p	CLIP-seq
MIRT2103331	hsa-miR-3158-3p	CLIP-seq
MIRT2103332	hsa-miR-4419a	CLIP-seq
MIRT2103333	hsa-miR-4510	CLIP-seq
MIRT2103334	hsa-miR-4694-3p	CLIP-seq
MIRT2103335	hsa-miR-516a-3p	CLIP-seq
MIRT2103336	hsa-miR-539	CLIP-seq
MIRT2103328	hsa-miR-1304	CLIP-seq
MIRT2103329	hsa-miR-3121-5p	CLIP-seq
MIRT2103330	hsa-miR-3126-5p	CLIP-seq
MIRT2103331	hsa-miR-3158-3p	CLIP-seq
MIRT2327619	hsa-miR-3188	CLIP-seq
MIRT2327620	hsa-miR-3929	CLIP-seq
MIRT2327621	hsa-miR-4260	CLIP-seq
MIRT2327622	hsa-miR-4276	CLIP-seq
MIRT2103332	hsa-miR-4419a	CLIP-seq
MIRT2327623	hsa-miR-4419b	CLIP-seq
MIRT2327624	hsa-miR-4478	CLIP-seq
MIRT2103333	hsa-miR-4510	CLIP-seq
MIRT2327625	hsa-miR-4640-5p	CLIP-seq
MIRT2103334	hsa-miR-4694-3p	CLIP-seq
MIRT2327626	hsa-miR-4726-5p	CLIP-seq
MIRT2103335	hsa-miR-516a-3p	CLIP-seq
MIRT2103336	hsa-miR-539	CLIP-seq
MIRT2327627	hsa-miR-653	CLIP-seq
MIRT2394519	hsa-miR-1265	CLIP-seq
MIRT2394520	hsa-miR-128	CLIP-seq
MIRT2394521	hsa-miR-1289	CLIP-seq
MIRT2394522	hsa-miR-2392	CLIP-seq
MIRT2394523	hsa-miR-27a	CLIP-seq
MIRT2394524	hsa-miR-27b	CLIP-seq
MIRT2103329	hsa-miR-3121-5p	CLIP-seq
MIRT2394525	hsa-miR-3689a-3p	CLIP-seq
MIRT2394526	hsa-miR-3689c	CLIP-seq
MIRT2394527	hsa-miR-4259	CLIP-seq
MIRT2394528	hsa-miR-4425	CLIP-seq
MIRT2394529	hsa-miR-4534	CLIP-seq
MIRT2394530	hsa-miR-4653-3p	CLIP-seq
MIRT2622661	hsa-miR-1228	CLIP-seq
MIRT2622662	hsa-miR-342-3p	CLIP-seq
MIRT2622663	hsa-miR-4733-3p	CLIP-seq
MIRT2622661	hsa-miR-1228	CLIP-seq
MIRT2622662	hsa-miR-342-3p	CLIP-seq
MIRT2622663	hsa-miR-4733-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005576	Component	Extracellular region	IEA
GO:0005769	Component	Early endosome	IBA
GO:0005770	Component	Late endosome	IBA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	28129379
GO:0005886	Component	Plasma membrane	IEA
GO:0006897	Process	Endocytosis	IEA
GO:0006954	Process	Inflammatory response	NAS	11133773
GO:0007155	Process	Cell adhesion	IEA
GO:0007160	Process	Cell-matrix adhesion	NAS	11133773
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11133773
GO:0030246	Function	Carbohydrate binding	IEA
GO:0030246	Function	Carbohydrate binding	NAS	11133773
GO:0032480	Process	Negative regulation of type I interferon production	IDA	26358190
GO:0032480	Process	Negative regulation of type I interferon production	IDA	26358190
GO:0032481	Process	Positive regulation of type I interferon production	IDA	14703513
GO:0046790	Function	Virion binding	IBA
GO:0075512	Process	Clathrin-dependent endocytosis of virus by host cell	IBA
GO:0098609	Process	Cell-cell adhesion	NAS	11133773

Other IDs

• MIM: 600751
• HGNC: 11127
• e!Ensembl: ENSG00000088827

Protein

• UniProt ID: Q9BZZ2
• Protein name: Sialoadhesin (Sialic acid-binding Ig-like lectin 1) (Siglec-1) (CD antigen CD169)
• Protein function: Macrophage-restricted adhesion molecule that mediates sialic-acid dependent binding to lymphocytes, including granulocytes, monocytes, natural killer cells, B-cells and CD8 T-cells. Plays a crucial role in limiting bacterial dissemination by eng
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	24 → 136	Immunoglobulin V-set domain	Domain
  PF08205	C2-set_2	142 → 228	CD80-like C2-set immunoglobulin domain	Domain
  PF13895	Ig_2	242 → 323	Immunoglobulin domain	Domain
  PF13895	Ig_2	326 → 408	Immunoglobulin domain	Domain
  PF07679	I-set	418 → 507	Immunoglobulin I-set domain	Domain
  PF13895	Ig_2	512 → 594	Immunoglobulin domain	Domain
  PF13895	Ig_2	896 → 978	Immunoglobulin domain	Domain
  PF07679	I-set	992 → 1083	Immunoglobulin I-set domain	Domain
  PF13895	Ig_2	1083 → 1168	Immunoglobulin domain	Domain
  PF13895	Ig_2	1262 → 1342	Immunoglobulin domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed by macrophages in various tissues. High levels are found in spleen, lymph node, perivascular macrophages in brain and lower levels in bone marrow, liver Kupffer cells and lamina propria of colon and lung. Also expressed by in
• Sequence:

  MGFLPKLLLLASFFPAGQASWGVSSPQDVQGVKGSCLLIPCIFSFPADVEVPDGITAIWY
  YDYSGQRQVVSHSADPKLVEARFRGRTEFMGNPEHRVCNLLLKDLQPEDSGSYNFRFEIS
  EVNRWSDVKGTLVTVTEEPRVPTIASPVELLEGTEVDFNCSTPYVCLQEQVRLQWQGQDP
  ARSVTFNSQKFEPTGVGHLETLHMAMSWQDHGRILRCQLSVANHRAQSEIHLQVKYAPKG
  VKILLSPSGRNILPGELVTLTCQVNSSYPAVSSIKWLKDGVRLQTKTGVLHLPQAAWSDA
  GVYTCQAENGVGSLVSPPISLHIFMAEVQVSPAGPILENQTVTLVCNTPNEAPSDLRYSW
  YKNHVLLEDAHSHTLRLHLATRADTGFYFCEVQNVHGSERSGPVSVVVNHPPLTPVLTAF
  LETQAGLVGILHCSVVSEPLATLVLSHGGHILASTSGDSDHSPRFSGTSGPNSLRLEIRD
  LEETDSGEYKCSATNSLGNATSTLDFHANAARLLISPAAEVVEGQAVTLSCRSGLSPTPD
  ARFSWYLNGALLHEGPGSSLLLPAASSTDAGSYHCRARDGHSASGPSSPAVLTVLYPPRQ
  PTFTTRLDLDAAGAGAGRRGLLLCRVDSDPPARLQLLHKDRVVATSLPSGGGCSTCGGCS
  PRMKVTKAPNLLRVEIHNPLLEEEGLYLCEASNALGNASTSATFNGQATVLAIAPSHTLQ
  EGTEANLTCNVSREAAGSPANFSWFRNGVLWAQGPLETVTLLPVARTDAALYACRILTEA
  GAQLSTPVLLSVLYPPDRPKLSALLDMGQGHMALFICTVDSRPLALLALFHGEHLLATSL
  GPQVPSHGRFQAKAEANSLKLEVRELGLGDSGSYRCEATNVLGSSNTSLFFQVRGAWVQV
  SPSPELQEGQAVVLSCQVHTGVPEGTSYRWYRDGQPLQESTSATLRFAAITLTQAGAYHC
  QAQAPGSATTSLAAPISLHVSYAPRHVTLTTLMDTGPGRLGLLLCRVDSDPPAQLRLLHG
  DRLVASTLQGVGGPEGSSPRLHVAVAPNTLRLEIHGAMLEDEGVYICEASNTLGQASASA
  DFDAQAVNVQVWPGATVREGQLVNLTCLVWTTHPAQLTYTWYQDGQQRLDAHSIPLPNVT
  VRDATSYRCGVGPPGRAPRLSRPITLDVLYAPRNLRLTYLLESHGGQLALVLCTVDSRPP
  AQLALSHAGRLLASSTAASVPNTLRLELRGPQPRDEGFYSCSARSPLGQANTSLELRLEG
  VRVILAPEAAVPEGAPITVTCADPAAHAPTLYTWYHNGRWLQEGPAASLSFLVATRAHAG
  AYSCQAQDAQGTRSSRPAALQVLYAPQDAVLSSFRDSRARSMAVIQCTVDSEPPAELALS
  HDGKVLATSSGVHSLASGTGHVQVARNALRLQVQDVPAGDDTYVCTAQNLLGSISTIGRL
  QVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTH
  VARAQAGMYHCLAELPTGAAASAPVMLRVLYPPKTPTMMVFVEPEGGLRGILDCRVDSEP
  LASLTLHLGSRLVASSQPQGAPAEPHIHVLASPNALRVDIEALRPSDQGEYICSASNVLG
  SASTSTYFGVRALHRLHQFQQLLWVLGLLVGLLLLLLGLGACYTWRRRRVCKQSMGENSV
  EMAFQKETTQLIDPDAATCETSTCAPPLG

• Sequence length: 1709

Pathways

KEGG:

Cell adhesion molecules

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	40033250	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	31824951		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	19285973, 27871915		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32483203	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	23331525		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	19285973, 27871915		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	26752092		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	29520898		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	30991022		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33299660, 37404831	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39173531	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30355653	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	29520898		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	22797009, 36652890	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33828127	Associate	★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	33986412	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	18414664	Associate	★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	20653431		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28694804, 31107535		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23734742, 26509874, 36846928	Associate	★☆☆☆☆ Found in Text Mining only
Complete atrioventricular block	Complete Atrioventricular Block	BEFREE	28501799, 30518570		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	19285973		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19285973		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	19285973		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	33986412	Associate	★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	34387304, 35177553	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24561305	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30356719		★☆☆☆☆ Found in Text Mining only
Emphysema	Emphysema	Pubtator	31992280, 38530936	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	28002629		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	32074080	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30516869		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30516869		★☆☆☆☆ Found in Text Mining only
Gastritis	Gastritis	Pubtator	36973348	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33408717, 34472004	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	BEFREE	29037117		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	12697073, 17330143		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	30053827		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	30053827	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	33828127	Stimulate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	31143782		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	20653431		★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	29562615	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28859328		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Cutaneous	Cutaneous lupus erythematosus	Pubtator	34081040	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	18383365, 30053827, 31790472, 33081587, 40281593	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	30988119	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28859328		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	LHGDN	18383365		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28859328, 30053827, 30988119		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28859328		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	33299660	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	30991022		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30516869		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28880401		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	29520898		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30516869		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30237798, 30764534		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	31247457		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28277099		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33986412	Associate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	35177553	Associate	★☆☆☆☆ Found in Text Mining only
Myositis Inclusion Body	Myositis	Pubtator	35177553	Stimulate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28359758, 30744470		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	37269647	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27309850		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36973348	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	22797009	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	37269647	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	40507944	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28880401		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	28880401		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	31992280, 38530936	Inhibit	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	24561305	Stimulate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23507374		★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	17330143	Associate	★☆☆☆☆ Found in Text Mining only
Scleroderma Diffuse	Scleroderma	Pubtator	20112379	Associate	★☆☆☆☆ Found in Text Mining only
Situs Inversus	Situs Inversus	BEFREE	18331725		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	20112379	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30744470		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	17328080		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	LHGDN	17328080		★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	33206973	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	29520898	Associate	★☆☆☆☆ Found in Text Mining only