Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	65983
Gene name	GRAM domain containing 2B
Gene symbol	GRAMD2B
Synonyms (NCBI Gene)	GRAMD3NS3TP2
Chromosome	5
Chromosome location	5q23.2

Show/Hide all (31)

miRTarBase ID	miRNA	Experiments	Reference
MIRT165172	hsa-miR-15a-5p	HITS-CLIP	19536157
MIRT165173	hsa-miR-16-5p	HITS-CLIP	19536157
MIRT165177	hsa-miR-15b-5p	HITS-CLIP	19536157
MIRT165180	hsa-miR-195-5p	HITS-CLIP	19536157
MIRT165183	hsa-miR-424-5p	HITS-CLIP	19536157
MIRT165184	hsa-miR-497-5p	HITS-CLIP	19536157
MIRT165221	hsa-miR-6838-5p	HITS-CLIP	19536157
MIRT165195	hsa-miR-548e-5p	HITS-CLIP	19536157
MIRT165199	hsa-miR-548p	HITS-CLIP	19536157
MIRT165178	hsa-miR-141-5p	HITS-CLIP	19536157
MIRT165224	hsa-miR-8063	HITS-CLIP	19536157
MIRT165186	hsa-miR-545-3p	HITS-CLIP	19536157
MIRT165212	hsa-miR-4742-5p	HITS-CLIP	19536157
MIRT165205	hsa-miR-548aj-5p	HITS-CLIP	19536157
MIRT165197	hsa-miR-548f-5p	HITS-CLIP	19536157
MIRT165198	hsa-miR-548g-5p	HITS-CLIP	19536157
MIRT165202	hsa-miR-548x-5p	HITS-CLIP	19536157
MIRT165190	hsa-miR-1468-3p	HITS-CLIP	19536157
MIRT165192	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT450363	hsa-miR-10a-3p	PAR-CLIP	22100165
MIRT450362	hsa-miR-409-3p	PAR-CLIP	22100165
MIRT450361	hsa-miR-33a-3p	PAR-CLIP	22100165
MIRT450360	hsa-miR-3200-3p	PAR-CLIP	22100165
MIRT450359	hsa-miR-3145-3p	PAR-CLIP	22100165
MIRT165172	hsa-miR-15a-5p	HITS-CLIP	22473208
MIRT165177	hsa-miR-15b-5p	HITS-CLIP	22473208
MIRT165173	hsa-miR-16-5p	HITS-CLIP	22473208
MIRT165180	hsa-miR-195-5p	HITS-CLIP	22473208
MIRT165176	hsa-miR-92a-3p	HITS-CLIP	22473208
MIRT165187	hsa-miR-92b-3p	HITS-CLIP	22473208
MIRT165175	hsa-miR-32-5p	HITS-CLIP	22473208

Show/Hide all (5)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	25416956, 25910212, 26871637, 29892012, 31515488, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005881	Component	Cytoplasmic microtubule	IBA
GO:0005881	Component	Cytoplasmic microtubule	IDA	23264731
GO:0042802	Function	Identical protein binding	IPI	25416956, 32296183

MIM	HGNC	e!Ensembl
620182	24911	ENSG00000155324

Q96HH9

Protein name

GRAM domain-containing protein 2B (HCV NS3-transactivated protein 2)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02893	GRAM	110 → 218	GRAM domain	Domain

Sequence

MTELQQDVEDTKPAKVLGKRESKLGSAHSEAENGVEEKKKACRSPTAQSPTPSVEADSPD
QKKIISLWSKSSFDGASLASDKNDCKTESKNDPKTERKKSSSSSQYKANMHFHKLFLSVP
TEEPLKQSFTCALQKEILYQGKLFVSENWICFHSKVFGKDTKISIPAFSVTLIKKTKTAL
LVPNALIIATVTDRYIFVSLLSRDSTYKLLKSVCGHLENTSVGNSPNPSSAENSFRADRP
SSLPLDFNDEFSDLDGVVQQRRQDMEGYSSSGSQTPESENSRDFHATESQTVLNVSKGEA
KPTRADAHVNRVPEGKAKSLPVQGLSETVGILHKVKSQKCPMLHHILIFYAIVVCALIIS
TFYMRYRINTLEEQLGLLTSIVDTHNTEQAAPSGLRSQVQFNVEVLCQELTANIVKLEKI
QNNLQKLLENGD

Sequence length

432

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (4)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31092297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	31092297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	20360305	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31092297		★★★★★ ★☆☆☆☆ Found in Text Mining only

GRAMD2B (GRAM domain containing 2B)