Gene Gene information from NCBI Gene database.
Entrez ID 65980
Gene name Bromodomain containing 9
Gene symbol BRD9
Synonyms (NCBI Gene)
LAVS3040PRO9856SMARCI2
Chromosome 5
Chromosome location 5p15.33
miRNA miRNA information provided by mirtarbase database.
95
miRTarBase ID miRNA Experiments Reference
MIRT728197 hsa-miR-19a-3p HITS-CLIP 22473208
MIRT728196 hsa-miR-19b-3p HITS-CLIP 22473208
MIRT824540 hsa-miR-1231 CLIP-seq
MIRT824541 hsa-miR-150 CLIP-seq
MIRT824542 hsa-miR-1914 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000785 Component Chromatin NAS 29374058
GO:0003676 Function Nucleic acid binding NAS 18559093
GO:0005515 Function Protein binding IPI 25416956, 32296183
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 25593309
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
618465 25818 ENSG00000028310
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H8M2
Protein name Bromodomain-containing protein 9 (Rhabdomyosarcoma antigen MU-RMS-40.8)
Protein function Plays a role in chromatin remodeling and regulation of transcription (PubMed:22464331, PubMed:26365797). Acts as a chromatin reader that recognizes and binds acylated histones: binds histones that are acetylated and/or butyrylated (PubMed:263657
PDB 3HME , 4NQN , 4UIT , 4UIU , 4UIV , 4UIW , 4XY8 , 4YY4 , 4YY6 , 4YYD , 4YYG , 4YYH , 4YYI , 4YYJ , 4YYK , 4Z6H , 4Z6I , 5E9V , 5EU1 , 5F1H , 5F1L , 5F25 , 5F2P , 5I40 , 5I7X , 5I7Y , 5IGM , 5IGN , 5JI8 , 5MKY , 5TWX , 6BQA , 6HM0 , 6UZF , 6V0S , 6V0X , 6V14 , 6V1B , 6Y7H , 6Y7I , 6Y7J , 6Y7K , 6Y7L , 6YQR , 6YQS , 6YQW , 8A7I , 8AHC
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00439 Bromodomain 142 228 Bromodomain Domain
PF12024 DUF3512 286 465 Domain of unknown function (DUF3512) Family
Sequence
MGKKHKKHKAEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHER
ERHKEKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREREHCDTEGEADDFDPGKKVEVEP
PPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHP
MDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKK
ILHAGFKMMSKQ
AALLGNEDTAVEEPVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVL
ALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLS
SKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQ
CALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNV
PMKPPDEAKVGDTLG
DSSSSVLEFMSMKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAE
RGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQSPEPAASAKT
Sequence length 597
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG 
  ATP-dependent chromatin remodeling  
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
10
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Cholangiocarcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Lung cancer Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Bone Diseases Bone disease Pubtator 36918560 Associate
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 32276436, 37870468 Associate
★☆☆☆☆
Found in Text Mining only
Carcinogenesis Carcinogenesis Pubtator 29575536, 38255982 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Carcinoma BEFREE 29575536
★☆☆☆☆
Found in Text Mining only
Carcinoma Hepatocellular Hepatocellular carcinoma Pubtator 34415102, 38303608 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 25370573, 29981437
★☆☆☆☆
Found in Text Mining only
Carcinoma Renal Cell Renal cell carcinoma Pubtator 34415102 Associate
★☆☆☆☆
Found in Text Mining only
Colonic Neoplasms Colonic neoplasm Pubtator 35778964 Associate
★☆☆☆☆
Found in Text Mining only
Colorectal Neoplasms Colorectal neoplasm Pubtator 35778964, 36297001 Associate
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus BEFREE 29754817
★☆☆☆☆
Found in Text Mining only