Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	65980
Gene name	Bromodomain containing 9
Gene symbol	BRD9
Synonyms (NCBI Gene)	LAVS3040PRO9856SMARCI2
Chromosome	5
Chromosome location	5p15.33

Show/Hide all (95)

miRTarBase ID	miRNA	Experiments	Reference
MIRT728197	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT728196	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT824540	hsa-miR-1231	CLIP-seq
MIRT824541	hsa-miR-150	CLIP-seq
MIRT824542	hsa-miR-1914	CLIP-seq
MIRT824543	hsa-miR-2115	CLIP-seq
MIRT824544	hsa-miR-329	CLIP-seq
MIRT824545	hsa-miR-335	CLIP-seq
MIRT824546	hsa-miR-3618	CLIP-seq
MIRT824547	hsa-miR-362-3p	CLIP-seq
MIRT824548	hsa-miR-3973	CLIP-seq
MIRT824549	hsa-miR-4288	CLIP-seq
MIRT824550	hsa-miR-4436a	CLIP-seq
MIRT824551	hsa-miR-4502	CLIP-seq
MIRT824552	hsa-miR-4670-5p	CLIP-seq
MIRT824553	hsa-miR-516a-3p	CLIP-seq
MIRT824554	hsa-miR-520g	CLIP-seq
MIRT824555	hsa-miR-520h	CLIP-seq
MIRT824556	hsa-miR-548ae	CLIP-seq
MIRT824557	hsa-miR-548aj	CLIP-seq
MIRT824558	hsa-miR-548am	CLIP-seq
MIRT824559	hsa-miR-548x	CLIP-seq
MIRT824560	hsa-miR-550a	CLIP-seq
MIRT824561	hsa-miR-632	CLIP-seq
MIRT824562	hsa-miR-934	CLIP-seq
MIRT824563	hsa-miR-140-3p	CLIP-seq
MIRT824564	hsa-miR-1915	CLIP-seq
MIRT824565	hsa-miR-3155	CLIP-seq
MIRT824566	hsa-miR-3155b	CLIP-seq
MIRT824567	hsa-miR-4275	CLIP-seq
MIRT824568	hsa-miR-4726-3p	CLIP-seq
MIRT824569	hsa-miR-483-3p	CLIP-seq
MIRT824570	hsa-miR-484	CLIP-seq
MIRT824571	hsa-miR-628-5p	CLIP-seq
MIRT1943726	hsa-miR-1324	CLIP-seq
MIRT1943727	hsa-miR-3151	CLIP-seq
MIRT1943728	hsa-miR-3166	CLIP-seq
MIRT1943729	hsa-miR-4257	CLIP-seq
MIRT824550	hsa-miR-4436a	CLIP-seq
MIRT1943730	hsa-miR-4462	CLIP-seq
MIRT1943731	hsa-miR-486-3p	CLIP-seq
MIRT824546	hsa-miR-3618	CLIP-seq
MIRT2182459	hsa-miR-425	CLIP-seq
MIRT824569	hsa-miR-483-3p	CLIP-seq
MIRT2182460	hsa-miR-603	CLIP-seq
MIRT2182461	hsa-miR-873	CLIP-seq
MIRT824562	hsa-miR-934	CLIP-seq
MIRT2486123	hsa-miR-1266	CLIP-seq
MIRT2486124	hsa-miR-1270	CLIP-seq
MIRT1943726	hsa-miR-1324	CLIP-seq
MIRT824563	hsa-miR-140-3p	CLIP-seq
MIRT824541	hsa-miR-150	CLIP-seq
MIRT824542	hsa-miR-1914	CLIP-seq
MIRT1943727	hsa-miR-3151	CLIP-seq
MIRT1943728	hsa-miR-3166	CLIP-seq
MIRT2486125	hsa-miR-3187-3p	CLIP-seq
MIRT824544	hsa-miR-329	CLIP-seq
MIRT824545	hsa-miR-335	CLIP-seq
MIRT824546	hsa-miR-3618	CLIP-seq
MIRT824547	hsa-miR-362-3p	CLIP-seq
MIRT2486126	hsa-miR-3677-3p	CLIP-seq
MIRT1943729	hsa-miR-4257	CLIP-seq
MIRT2486127	hsa-miR-4283	CLIP-seq
MIRT2486128	hsa-miR-432	CLIP-seq
MIRT824550	hsa-miR-4436a	CLIP-seq
MIRT1943730	hsa-miR-4462	CLIP-seq
MIRT2486129	hsa-miR-4489	CLIP-seq
MIRT2486130	hsa-miR-4518	CLIP-seq
MIRT2486131	hsa-miR-4522	CLIP-seq
MIRT2486132	hsa-miR-4529-5p	CLIP-seq
MIRT2486133	hsa-miR-4531	CLIP-seq
MIRT824552	hsa-miR-4670-5p	CLIP-seq
MIRT2486134	hsa-miR-4760-3p	CLIP-seq
MIRT2486135	hsa-miR-4777-3p	CLIP-seq
MIRT824569	hsa-miR-483-3p	CLIP-seq
MIRT1943731	hsa-miR-486-3p	CLIP-seq
MIRT824560	hsa-miR-550a	CLIP-seq
MIRT2486136	hsa-miR-620	CLIP-seq
MIRT2486137	hsa-miR-664	CLIP-seq
MIRT824562	hsa-miR-934	CLIP-seq
MIRT1943726	hsa-miR-1324	CLIP-seq
MIRT824541	hsa-miR-150	CLIP-seq
MIRT824542	hsa-miR-1914	CLIP-seq
MIRT1943727	hsa-miR-3151	CLIP-seq
MIRT1943728	hsa-miR-3166	CLIP-seq
MIRT824544	hsa-miR-329	CLIP-seq
MIRT824545	hsa-miR-335	CLIP-seq
MIRT824546	hsa-miR-3618	CLIP-seq
MIRT824547	hsa-miR-362-3p	CLIP-seq
MIRT1943729	hsa-miR-4257	CLIP-seq
MIRT824550	hsa-miR-4436a	CLIP-seq
MIRT824552	hsa-miR-4670-5p	CLIP-seq
MIRT1943731	hsa-miR-486-3p	CLIP-seq
MIRT824560	hsa-miR-550a	CLIP-seq
MIRT824562	hsa-miR-934	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	NAS	29374058
GO:0003676	Function	Nucleic acid binding	NAS	18559093
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	25593309
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	NAS	29374058
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	NAS	29374058
GO:0008284	Process	Positive regulation of cell population proliferation	NAS	29374058
GO:0016514	Component	SWI/SNF complex	IDA	23644491, 29374058
GO:0045596	Process	Negative regulation of cell differentiation	NAS	30510198
GO:0140288	Component	GBAF complex	NAS	29374058
GO:0140566	Function	Histone reader activity	IBA
GO:0140566	Function	Histone reader activity	IDA	22464331
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	30510198

MIM	HGNC	e!Ensembl
618465	25818	ENSG00000028310

Q9H8M2

Protein name

Bromodomain-containing protein 9 (Rhabdomyosarcoma antigen MU-RMS-40.8)

Protein function

Plays a role in chromatin remodeling and regulation of transcription (PubMed:22464331, PubMed:26365797). Acts as a chromatin reader that recognizes and binds acylated histones: binds histones that are acetylated and/or butyrylated (PubMed:263657

PDB

3HME , 4NQN , 4UIT , 4UIU , 4UIV , 4UIW , 4XY8 , 4YY4 , 4YY6 , 4YYD , 4YYG , 4YYH , 4YYI , 4YYJ , 4YYK , 4Z6H , 4Z6I , 5E9V , 5EU1 , 5F1H , 5F1L , 5F25 , 5F2P , 5I40 , 5I7X , 5I7Y , 5IGM , 5IGN , 5JI8 , 5MKY , 5TWX , 6BQA , 6HM0 , 6UZF , 6V0S , 6V0X , 6V14 , 6V1B , 6Y7H , 6Y7I , 6Y7J , 6Y7K , 6Y7L , 6YQR , 6YQS , 6YQW , 8A7I , 8AHC

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00439	Bromodomain	142 → 228	Bromodomain	Domain
PF12024	DUF3512	286 → 465	Domain of unknown function (DUF3512)	Family

Sequence

MGKKHKKHKAEWRSSYEDYADKPLEKPLKLVLKVGGSEVTELSGSGHDSSYYDDRSDHER
ERHKEKKKKKKKKSEKEKHLDDEERRKRKEEKKRKREREHCDTEGEADDFDPGKKVEVEP
PPDRPVRACRTQPAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHP
MDFGTMKDKIVANEYKSVTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQ
AALLGNEDTAVEEPVPEVVPVQVETAKKSKKPSREVISCMFEPEGNACSLTDSTAEEHVL
ALVEHAADEARDRINRFLPGGKMGYLKRNGDGSLLYSVVNTAEPDADEEETHPVDLSSLS
SKLLPGFTTLGFKDERRNKVTFLSSATTALSMQNNSVFGDLKSDEMELLYSAYGDETGVQ
CALSLQEFVKDAGSYSKKVVDDLLDQITGGDHSRTLFQLKQRRNVPMKPPDEAKVGDTLG
DSSSSVLEFMSMKSYPDVSVDISMLSSLGKVKKELDPDDSHLNLDETTKLLQDLHEAQAE
RGGSRPSSNLSSLSNASERDQHHLGSPSRLSVGEQPDVTHDPYEFLQSPEPAASAKT

Sequence length

597

Interactions

View interactions

	KEGG
	ATP-dependent chromatin remodeling

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEZARY SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (39)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bone Diseases	Bone disease	Pubtator	36918560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	32276436, 37870468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29575536, 38255982	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29575536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34415102, 38303608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	25370573, 29981437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	34415102	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	35778964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35778964, 36297001	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29754817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Diseases	Hematologic disease	Pubtator	36918560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29754817		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	38255982	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	35883603	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31000698, 35853853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31000698, 34415102, 35853853, 38126767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27376689, 28418626, 31000698		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	29981437	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	29981437		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27376689, 28418626, 28714904, 30760718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	38070581, 38303608	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	38070581	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	35853853, 36780189	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30760718		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34944438	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	35778964	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	28714904, 30397315, 31015438, 31558726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	31015438	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35853853	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	30397315	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	30431433	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	CTD_human_DG	26551667		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	30660651		★★★★★ ★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	30431433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	32065787	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31000582		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31000582	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18559093	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	31597964		★★★★★ ★☆☆☆☆ Found in Text Mining only

BRD9 (bromodomain containing 9)