Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6596
Gene name	Helicase like transcription factor
Gene symbol	HLTF
Synonyms (NCBI Gene)	HIP116HIP116AHLTF1RNF80SMARCA3SNF2L3ZBU1
Chromosome	3
Chromosome location	3q24
Summary	This gene encodes a member of the SWI/SNF family. Members of this family have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. The encoded protein contains a

205

Show/Hide all (205)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021505	hsa-miR-145-5p	Reporter assay;Microarray	21351259
MIRT708805	hsa-miR-3664-5p	HITS-CLIP	19536157
MIRT708804	hsa-miR-6758-3p	HITS-CLIP	19536157
MIRT708803	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT708802	hsa-miR-4263	HITS-CLIP	19536157
MIRT708801	hsa-miR-576-5p	HITS-CLIP	19536157
MIRT708805	hsa-miR-3664-5p	HITS-CLIP	19536157
MIRT708804	hsa-miR-6758-3p	HITS-CLIP	19536157
MIRT708803	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT708802	hsa-miR-4263	HITS-CLIP	19536157
MIRT708801	hsa-miR-576-5p	HITS-CLIP	19536157
MIRT708805	hsa-miR-3664-5p	HITS-CLIP	19536157
MIRT708804	hsa-miR-6758-3p	HITS-CLIP	19536157
MIRT708803	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT708802	hsa-miR-4263	HITS-CLIP	19536157
MIRT708801	hsa-miR-576-5p	HITS-CLIP	19536157
MIRT708805	hsa-miR-3664-5p	HITS-CLIP	19536157
MIRT708804	hsa-miR-6758-3p	HITS-CLIP	19536157
MIRT708803	hsa-miR-4742-3p	HITS-CLIP	19536157
MIRT708802	hsa-miR-4263	HITS-CLIP	19536157
MIRT708801	hsa-miR-576-5p	HITS-CLIP	19536157
MIRT1048695	hsa-miR-133a	CLIP-seq
MIRT1048696	hsa-miR-133b	CLIP-seq
MIRT1048697	hsa-miR-137	CLIP-seq
MIRT1048698	hsa-miR-144	CLIP-seq
MIRT1048699	hsa-miR-191	CLIP-seq
MIRT1048700	hsa-miR-1972	CLIP-seq
MIRT1048701	hsa-miR-3613-3p	CLIP-seq
MIRT1048702	hsa-miR-3616-5p	CLIP-seq
MIRT1048703	hsa-miR-3647-5p	CLIP-seq
MIRT1048704	hsa-miR-371-5p	CLIP-seq
MIRT1048705	hsa-miR-371b-5p	CLIP-seq
MIRT1048706	hsa-miR-374c	CLIP-seq
MIRT1048707	hsa-miR-376c	CLIP-seq
MIRT1048708	hsa-miR-410	CLIP-seq
MIRT1048709	hsa-miR-4457	CLIP-seq
MIRT1048710	hsa-miR-4475	CLIP-seq
MIRT1048711	hsa-miR-4650-5p	CLIP-seq
MIRT1048712	hsa-miR-4666-3p	CLIP-seq
MIRT1048713	hsa-miR-4670-3p	CLIP-seq
MIRT1048714	hsa-miR-4717-5p	CLIP-seq
MIRT1048715	hsa-miR-513b	CLIP-seq
MIRT1048716	hsa-miR-513c	CLIP-seq
MIRT1048717	hsa-miR-514b-5p	CLIP-seq
MIRT1048718	hsa-miR-548l	CLIP-seq
MIRT1048719	hsa-miR-548n	CLIP-seq
MIRT1048720	hsa-miR-573	CLIP-seq
MIRT1048721	hsa-miR-595	CLIP-seq
MIRT1048722	hsa-miR-655	CLIP-seq
MIRT1048723	hsa-miR-944	CLIP-seq
MIRT1048724	hsa-miR-145	CLIP-seq
MIRT1048725	hsa-miR-1825	CLIP-seq
MIRT1048726	hsa-miR-199a-5p	CLIP-seq
MIRT1048727	hsa-miR-199b-5p	CLIP-seq
MIRT1048728	hsa-miR-3119	CLIP-seq
MIRT1048706	hsa-miR-374c	CLIP-seq
MIRT1048709	hsa-miR-4457	CLIP-seq
MIRT1048712	hsa-miR-4666-3p	CLIP-seq
MIRT1048729	hsa-miR-4698	CLIP-seq
MIRT1048715	hsa-miR-513b	CLIP-seq
MIRT1048722	hsa-miR-655	CLIP-seq
MIRT1048730	hsa-miR-888	CLIP-seq
MIRT2011056	hsa-miR-1184	CLIP-seq
MIRT2011057	hsa-miR-1205	CLIP-seq
MIRT2011058	hsa-miR-1270	CLIP-seq
MIRT2011059	hsa-miR-1271	CLIP-seq
MIRT2011060	hsa-miR-1278	CLIP-seq
MIRT2011061	hsa-miR-1298	CLIP-seq
MIRT1048724	hsa-miR-145	CLIP-seq
MIRT2011062	hsa-miR-182	CLIP-seq
MIRT1048725	hsa-miR-1825	CLIP-seq
MIRT1048726	hsa-miR-199a-5p	CLIP-seq
MIRT1048727	hsa-miR-199b-5p	CLIP-seq
MIRT2011063	hsa-miR-204	CLIP-seq
MIRT2011064	hsa-miR-211	CLIP-seq
MIRT2011065	hsa-miR-223	CLIP-seq
MIRT2011066	hsa-miR-298	CLIP-seq
MIRT1048728	hsa-miR-3119	CLIP-seq
MIRT2011067	hsa-miR-3120-3p	CLIP-seq
MIRT2011068	hsa-miR-3129-3p	CLIP-seq
MIRT2011069	hsa-miR-3143	CLIP-seq
MIRT2011070	hsa-miR-3144-3p	CLIP-seq
MIRT2011071	hsa-miR-3158-5p	CLIP-seq
MIRT2011072	hsa-miR-3163	CLIP-seq
MIRT2011073	hsa-miR-3664-3p	CLIP-seq
MIRT2011074	hsa-miR-412	CLIP-seq
MIRT2011075	hsa-miR-4282	CLIP-seq
MIRT2011076	hsa-miR-433	CLIP-seq
MIRT2011077	hsa-miR-4433	CLIP-seq
MIRT2011078	hsa-miR-4459	CLIP-seq
MIRT2011079	hsa-miR-4476	CLIP-seq
MIRT2011080	hsa-miR-4531	CLIP-seq
MIRT2011081	hsa-miR-4642	CLIP-seq
MIRT2011082	hsa-miR-4683	CLIP-seq
MIRT2011083	hsa-miR-4690-3p	CLIP-seq
MIRT2011084	hsa-miR-4697-3p	CLIP-seq
MIRT2011085	hsa-miR-4724-3p	CLIP-seq
MIRT2011086	hsa-miR-4735-5p	CLIP-seq
MIRT2011087	hsa-miR-4749-3p	CLIP-seq
MIRT2011088	hsa-miR-4755-5p	CLIP-seq
MIRT2011089	hsa-miR-4768-3p	CLIP-seq
MIRT2011090	hsa-miR-4775	CLIP-seq
MIRT2011091	hsa-miR-4803	CLIP-seq
MIRT2011092	hsa-miR-488	CLIP-seq
MIRT2011093	hsa-miR-513a-3p	CLIP-seq
MIRT2011094	hsa-miR-544	CLIP-seq
MIRT2011095	hsa-miR-548a-3p	CLIP-seq
MIRT2011096	hsa-miR-548e	CLIP-seq
MIRT2011097	hsa-miR-548f	CLIP-seq
MIRT2011098	hsa-miR-590-3p	CLIP-seq
MIRT2011099	hsa-miR-592	CLIP-seq
MIRT1048721	hsa-miR-595	CLIP-seq
MIRT2011100	hsa-miR-597	CLIP-seq
MIRT2011101	hsa-miR-599	CLIP-seq
MIRT2011102	hsa-miR-620	CLIP-seq
MIRT2011103	hsa-miR-875-5p	CLIP-seq
MIRT2011104	hsa-miR-96	CLIP-seq
MIRT2243371	hsa-miR-155	CLIP-seq
MIRT1048697	hsa-miR-137	CLIP-seq
MIRT2451246	hsa-miR-129-5p	CLIP-seq
MIRT2451247	hsa-miR-151-3p	CLIP-seq
MIRT2451248	hsa-miR-4463	CLIP-seq
MIRT2451249	hsa-miR-4499	CLIP-seq
MIRT2451250	hsa-miR-4776-3p	CLIP-seq
MIRT2451251	hsa-miR-892a	CLIP-seq
MIRT2546527	hsa-miR-1208	CLIP-seq
MIRT2546528	hsa-miR-1244	CLIP-seq
MIRT2011058	hsa-miR-1270	CLIP-seq
MIRT2011059	hsa-miR-1271	CLIP-seq
MIRT2011062	hsa-miR-182	CLIP-seq
MIRT2011063	hsa-miR-204	CLIP-seq
MIRT2011064	hsa-miR-211	CLIP-seq
MIRT2546529	hsa-miR-3126-3p	CLIP-seq
MIRT2011070	hsa-miR-3144-3p	CLIP-seq
MIRT2546530	hsa-miR-3157-3p	CLIP-seq
MIRT2546531	hsa-miR-3182	CLIP-seq
MIRT2546532	hsa-miR-342-3p	CLIP-seq
MIRT1048701	hsa-miR-3613-3p	CLIP-seq
MIRT1048705	hsa-miR-371b-5p	CLIP-seq
MIRT2546533	hsa-miR-4270	CLIP-seq
MIRT2546534	hsa-miR-4299	CLIP-seq
MIRT2546535	hsa-miR-4420	CLIP-seq
MIRT2546536	hsa-miR-4427	CLIP-seq
MIRT2546537	hsa-miR-4441	CLIP-seq
MIRT2546538	hsa-miR-4456	CLIP-seq
MIRT1048710	hsa-miR-4475	CLIP-seq
MIRT2546539	hsa-miR-451b	CLIP-seq
MIRT2011080	hsa-miR-4531	CLIP-seq
MIRT2011081	hsa-miR-4642	CLIP-seq
MIRT2546540	hsa-miR-4680-3p	CLIP-seq
MIRT2011082	hsa-miR-4683	CLIP-seq
MIRT2011083	hsa-miR-4690-3p	CLIP-seq
MIRT2546541	hsa-miR-4699-5p	CLIP-seq
MIRT2546542	hsa-miR-4710	CLIP-seq
MIRT2011085	hsa-miR-4724-3p	CLIP-seq
MIRT2011088	hsa-miR-4755-5p	CLIP-seq
MIRT2546543	hsa-miR-4760-3p	CLIP-seq
MIRT2546544	hsa-miR-4792	CLIP-seq
MIRT2546545	hsa-miR-4794	CLIP-seq
MIRT2546546	hsa-miR-548q	CLIP-seq
MIRT2011102	hsa-miR-620	CLIP-seq
MIRT2546547	hsa-miR-623	CLIP-seq
MIRT2011103	hsa-miR-875-5p	CLIP-seq
MIRT2011104	hsa-miR-96	CLIP-seq
MIRT2546527	hsa-miR-1208	CLIP-seq
MIRT2011058	hsa-miR-1270	CLIP-seq
MIRT2011059	hsa-miR-1271	CLIP-seq
MIRT2011062	hsa-miR-182	CLIP-seq
MIRT2682327	hsa-miR-1911	CLIP-seq
MIRT2011063	hsa-miR-204	CLIP-seq
MIRT2011064	hsa-miR-211	CLIP-seq
MIRT2546529	hsa-miR-3126-3p	CLIP-seq
MIRT2011070	hsa-miR-3144-3p	CLIP-seq
MIRT2682328	hsa-miR-320a	CLIP-seq
MIRT2682329	hsa-miR-320b	CLIP-seq
MIRT2682330	hsa-miR-320c	CLIP-seq
MIRT2682331	hsa-miR-320d	CLIP-seq
MIRT1048701	hsa-miR-3613-3p	CLIP-seq
MIRT1048705	hsa-miR-371b-5p	CLIP-seq
MIRT2546533	hsa-miR-4270	CLIP-seq
MIRT2546534	hsa-miR-4299	CLIP-seq
MIRT2546535	hsa-miR-4420	CLIP-seq
MIRT2682332	hsa-miR-4429	CLIP-seq
MIRT2546537	hsa-miR-4441	CLIP-seq
MIRT2546538	hsa-miR-4456	CLIP-seq
MIRT1048710	hsa-miR-4475	CLIP-seq
MIRT2546539	hsa-miR-451b	CLIP-seq
MIRT2011080	hsa-miR-4531	CLIP-seq
MIRT2011081	hsa-miR-4642	CLIP-seq
MIRT2011082	hsa-miR-4683	CLIP-seq
MIRT2011083	hsa-miR-4690-3p	CLIP-seq
MIRT2546541	hsa-miR-4699-5p	CLIP-seq
MIRT2546542	hsa-miR-4710	CLIP-seq
MIRT2011085	hsa-miR-4724-3p	CLIP-seq
MIRT2011088	hsa-miR-4755-5p	CLIP-seq
MIRT2546543	hsa-miR-4760-3p	CLIP-seq
MIRT2546544	hsa-miR-4792	CLIP-seq
MIRT2546545	hsa-miR-4794	CLIP-seq
MIRT2546546	hsa-miR-548q	CLIP-seq
MIRT2011102	hsa-miR-620	CLIP-seq
MIRT2546547	hsa-miR-623	CLIP-seq
MIRT2682333	hsa-miR-7	CLIP-seq
MIRT2011103	hsa-miR-875-5p	CLIP-seq
MIRT2682334	hsa-miR-890	CLIP-seq
MIRT2011104	hsa-miR-96	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
PGR	Activation	12890680

Show/Hide all (47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000209	Process	Protein polyubiquitination	IDA	18316726, 18719106
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IDA	26051180
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003824	Function	Catalytic activity	IEA
GO:0004386	Function	Helicase activity	IEA
GO:0005515	Function	Protein binding	IPI	10391891, 18316726, 18719106, 23415230
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	NAS	3126079
GO:0006281	Process	DNA repair	IBA
GO:0006325	Process	Chromatin organization	IEA
GO:0006974	Process	DNA damage response	IDA	18316726, 18719106
GO:0008094	Function	ATP-dependent activity, acting on DNA	IBA
GO:0008094	Function	ATP-dependent activity, acting on DNA	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0015616	Function	DNA translocase activity	IDA	19948885, 26051180
GO:0016020	Component	Membrane	HDA	19946888
GO:0016363	Component	Nuclear matrix	NAS	23415230
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016567	Process	Protein ubiquitination	TAS
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0016818	Function	Hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	IDA	25023518
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	ISO
GO:0043596	Component	Nuclear replication fork	IC	19948885
GO:0043596	Component	Nuclear replication fork	IDA	26051180
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISO
GO:0046872	Function	Metal ion binding	IEA
GO:0050767	Process	Regulation of neurogenesis	IEA
GO:0050767	Process	Regulation of neurogenesis	ISO
GO:0061630	Function	Ubiquitin protein ligase activity	EXP	18316726, 18719106, 19723507, 21396873, 26350214
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0071932	Process	Replication fork reversal	IDA	19948885, 26051180
GO:0090575	Component	RNA polymerase II transcription regulator complex	EXP	23415230
GO:0090575	Component	RNA polymerase II transcription regulator complex	IEA

MIM	HGNC	e!Ensembl
603257	11099	ENSG00000071794

Q14527

Protein name

Helicase-like transcription factor (EC 2.3.2.27) (EC 3.6.4.-) (DNA-binding protein/plasminogen activator inhibitor 1 regulator) (HIP116) (RING finger protein 80) (RING-type E3 ubiquitin transferase HLTF) (SWI/SNF-related matrix-associated actin-dependent

Protein function

Has both helicase and E3 ubiquitin ligase activities. Possesses intrinsic ATP-dependent nucleosome-remodeling activity; This activity may be required for transcriptional activation or repression of specific target promoters (By similarity). Thes

PDB

2MZN , 4HRE , 4HRH , 4S0N , 4XZF , 4XZG , 5BNH , 5K5F , 6KCS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08797	HIRAN	60 → 154	HIRAN domain	Domain
PF00176	SNF2_N	243 → 722	SNF2 family N-terminal domain	Family
PF13923	zf-C3HC4_2	759 → 800		Domain
PF00271	Helicase_C	833 → 950	Helicase conserved C-terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in brain, heart, kidney, liver, lung, pancreas, placenta and skeletal muscle. {ECO:0000269|PubMed:8672239, ECO:0000269|PubMed:9126292}.

Sequence

MSWMFKRDPVWKYLQTVQYGVHGNFPRLSYPTFFPRFEFQDVIPPDDFLTSDEEVDSVLF
GSLRGHVVGLRYYTGVVNNNEMVALQRDPNNPYDKNAIKVNNVNGNQVGHLKKELAGALA
YIMDNKLAQIEGVVPFGANNAFTMPLHMTFWGKEENRKAVSDQLKKHGFKLGPAPKTLGF
NLESGWGSGRAGPSYSMPVHAAVQMTTEQLKTEFDKLFEDLKEDDKTHEMEPAEAIETPL
LPHQKQALAWMVSRENSKELPPFWEQRNDLYYNTITNFSEKDRPENVHGGILADDMGLGK
TLTAIAVILTNFHDGRPLPIERVKKNLLKKEYNVNDDSMKLGGNNTSEKADGLSKDASRC
SEQPSISDIKEKSKFRMSELSSSRPKRRKTAVQYIESSDSEEIETSELPQKMKGKLKNVQ
SETKGRAKAGSSKVIEDVAFACALTSSVPTTKKKMLKKGACAVEGSKKTDVEERPRTTLI
ICPLSVLSNWIDQFGQHIKSDVHLNFYVYYGPDRIREPALLSKQDIVLTTYNILTHDYGT
KGDSPLHSIRWLRVILDEGHAIRNPNAQQTKAVLDLESERRWVLTGTPIQNSLKDLWSLL
SFLKLKPFIDREWWHRTIQRPVTMGDEGGLRRLQSLIKNITLRRTKTSKIKGKPVLELPE
RKVFIQHITLSDEERKIYQSVKNEGRATIGRYFNEGTVLAHYADVLGLLLRLRQICCHTY
LLTNAVSSNGPSGNDTPEELRKKLIRKMKLILSSGSDEECAICLDSLTVPVITHCAHVFC
KPCICQVIQNEQPHAKCPLCRNDIHEDNLLECPPEELARDSEKKSDMEWTSSSKINALMH
ALTDLRKKNPNIKSLVVSQFTTFLSLIEIPLKASGFVFTRLDGSMAQKKRVESIQCFQNT
EAGSPTIMLLSLKAGGVGLNLSAASRVFLMDPAWNPAAEDQCFDRCHRLGQKQEVIITKF
IVKDSVEENMLKIQNKKRELAAGAFGTKKPNADEMKQAKINEIRTLIDL

Sequence length

1009

Interactions

View interactions

	Reactome
			E3 ubiquitin ligases ubiquitinate target proteins

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (10)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HLTF-related disorder	Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (66)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	29661164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	22452792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	16181380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19948885, 36822623	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12584739, 22452792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36822623	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	29661164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	29661164	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	20535496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	20535496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11904375, 12901794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	11904375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11904375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	22452792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	12766908, 19282772, 22362391, 24708595, 30320371, 31461471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11904375, 12901794, 18316726	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16475679, 24708595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	31461471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	26802049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	31461471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	28954549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	27029739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	17094449	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	26456195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	21531217		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29747023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	29323743		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	22761659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	22452792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	16762066, 18034322		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	16762066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	26802049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26802049	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26802049, 30696947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	22766745		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20849603	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29747023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12584739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	26456195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	16762066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11904375, 29661164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	12766908, 16497821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	25005870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11904375, 12766908, 16762066, 18034322, 19723507, 20535496, 22452792, 25005870, 26472339, 28954549, 29661164, 30528265, 31350889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	20535496		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11904375, 12584739, 12901794, 22452792		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	30696947		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30696947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neonatal hypoglycemia	Hypoglycemia	BEFREE	29975766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12901794, 16762066, 18034322, 21531217, 22362391, 26472339, 29661164, 30320371, 31461471		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29661164		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	16762066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17094449, 18825407		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	17094449		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	29661164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	12766908, 12901794, 16497821		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	12766908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12901794	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	16497821	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	BEFREE	16762066		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	25005870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25005870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	25005870	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Nodule	Thyroid Nodule	BEFREE	25005870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24577895	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	20535496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HLTF (helicase like transcription factor)