Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6579
Gene name	Solute carrier organic anion transporter family member 1A2
Gene symbol	SLCO1A2
Synonyms (NCBI Gene)	OATPOATP-AOATP1A2SLC21A3
Chromosome	12
Chromosome location	12p12.1
Summary	This gene encodes a sodium-independent transporter which mediates cellular uptake of organic ions in the liver. Its substrates include bile acids, bromosulphophthalein, and some steroidal compounds. The protein is a member of the SLC21A family of solute c

Show/Hide all (90)

miRTarBase ID	miRNA	Experiments
MIRT1369231	hsa-miR-1207-5p	CLIP-seq
MIRT1369232	hsa-miR-1224-3p	CLIP-seq
MIRT1369233	hsa-miR-1236	CLIP-seq
MIRT1369234	hsa-miR-1260	CLIP-seq
MIRT1369235	hsa-miR-1260b	CLIP-seq
MIRT1369236	hsa-miR-128	CLIP-seq
MIRT1369237	hsa-miR-1280	CLIP-seq
MIRT1369238	hsa-miR-1285	CLIP-seq
MIRT1369239	hsa-miR-1302	CLIP-seq
MIRT1369240	hsa-miR-136	CLIP-seq
MIRT1369241	hsa-miR-3145-5p	CLIP-seq
MIRT1369242	hsa-miR-3147	CLIP-seq
MIRT1369243	hsa-miR-3187-5p	CLIP-seq
MIRT1369244	hsa-miR-3667-3p	CLIP-seq
MIRT1369245	hsa-miR-3679-3p	CLIP-seq
MIRT1369246	hsa-miR-3686	CLIP-seq
MIRT1369247	hsa-miR-378g	CLIP-seq
MIRT1369248	hsa-miR-4278	CLIP-seq
MIRT1369249	hsa-miR-4298	CLIP-seq
MIRT1369250	hsa-miR-4314	CLIP-seq
MIRT1369251	hsa-miR-4425	CLIP-seq
MIRT1369252	hsa-miR-4486	CLIP-seq
MIRT1369253	hsa-miR-4648	CLIP-seq
MIRT1369254	hsa-miR-4668-3p	CLIP-seq
MIRT1369255	hsa-miR-4716-5p	CLIP-seq
MIRT1369256	hsa-miR-4724-5p	CLIP-seq
MIRT1369257	hsa-miR-4747-5p	CLIP-seq
MIRT1369258	hsa-miR-4753-3p	CLIP-seq
MIRT1369259	hsa-miR-4763-3p	CLIP-seq
MIRT1369260	hsa-miR-4781-3p	CLIP-seq
MIRT1369261	hsa-miR-4793-5p	CLIP-seq
MIRT1369262	hsa-miR-4795-5p	CLIP-seq
MIRT1369263	hsa-miR-508-5p	CLIP-seq
MIRT1369264	hsa-miR-513a-3p	CLIP-seq
MIRT1369265	hsa-miR-532-3p	CLIP-seq
MIRT1369266	hsa-miR-548c-3p	CLIP-seq
MIRT1369267	hsa-miR-550b	CLIP-seq
MIRT1369268	hsa-miR-612	CLIP-seq
MIRT1369269	hsa-miR-1178	CLIP-seq
MIRT1369231	hsa-miR-1207-5p	CLIP-seq
MIRT1369270	hsa-miR-1208	CLIP-seq
MIRT1369236	hsa-miR-128	CLIP-seq
MIRT1369238	hsa-miR-1285	CLIP-seq
MIRT1369239	hsa-miR-1302	CLIP-seq
MIRT1369271	hsa-miR-18a	CLIP-seq
MIRT1369272	hsa-miR-18b	CLIP-seq
MIRT1369273	hsa-miR-3120-3p	CLIP-seq
MIRT1369274	hsa-miR-3123	CLIP-seq
MIRT1369275	hsa-miR-3150b-3p	CLIP-seq
MIRT1369276	hsa-miR-3154	CLIP-seq
MIRT1369277	hsa-miR-3159	CLIP-seq
MIRT1369278	hsa-miR-3163	CLIP-seq
MIRT1369243	hsa-miR-3187-5p	CLIP-seq
MIRT1369279	hsa-miR-3613-5p	CLIP-seq
MIRT1369280	hsa-miR-3655	CLIP-seq
MIRT1369281	hsa-miR-3692	CLIP-seq
MIRT1369247	hsa-miR-378g	CLIP-seq
MIRT1369282	hsa-miR-382	CLIP-seq
MIRT1369283	hsa-miR-3907	CLIP-seq
MIRT1369249	hsa-miR-4298	CLIP-seq
MIRT1369284	hsa-miR-4303	CLIP-seq
MIRT1369285	hsa-miR-431	CLIP-seq
MIRT1369250	hsa-miR-4314	CLIP-seq
MIRT1369286	hsa-miR-4459	CLIP-seq
MIRT1369287	hsa-miR-4468	CLIP-seq
MIRT1369288	hsa-miR-4474-5p	CLIP-seq
MIRT1369252	hsa-miR-4486	CLIP-seq
MIRT1369253	hsa-miR-4648	CLIP-seq
MIRT1369254	hsa-miR-4668-3p	CLIP-seq
MIRT1369289	hsa-miR-4689	CLIP-seq
MIRT1369290	hsa-miR-4700-3p	CLIP-seq
MIRT1369291	hsa-miR-4722-5p	CLIP-seq
MIRT1369292	hsa-miR-4735-3p	CLIP-seq
MIRT1369259	hsa-miR-4763-3p	CLIP-seq
MIRT1369293	hsa-miR-4784	CLIP-seq
MIRT1369262	hsa-miR-4795-5p	CLIP-seq
MIRT1369294	hsa-miR-5095	CLIP-seq
MIRT1369295	hsa-miR-511	CLIP-seq
MIRT1369264	hsa-miR-513a-3p	CLIP-seq
MIRT1369296	hsa-miR-600	CLIP-seq
MIRT1369297	hsa-miR-605	CLIP-seq
MIRT1369268	hsa-miR-612	CLIP-seq
MIRT1369298	hsa-miR-892a	CLIP-seq
MIRT2109667	hsa-miR-4320	CLIP-seq
MIRT2109668	hsa-miR-4633-5p	CLIP-seq
MIRT2109669	hsa-miR-491-3p	CLIP-seq
MIRT2109670	hsa-miR-520d-5p	CLIP-seq
MIRT2109671	hsa-miR-524-5p	CLIP-seq
MIRT2109672	hsa-miR-532-5p	CLIP-seq
MIRT2332909	hsa-miR-593	CLIP-seq

Show/Hide all (26)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005886	Component	Plasma membrane	IDA	25132355
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006805	Process	Xenobiotic metabolic process	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006869	Process	Lipid transport	IEA
GO:0008514	Function	Organic anion transmembrane transporter activity	IDA	10873595, 19129463
GO:0008514	Function	Organic anion transmembrane transporter activity	TAS	9007731
GO:0009925	Component	Basal plasma membrane	IDA	35307651
GO:0009925	Component	Basal plasma membrane	IEA
GO:0015101	Function	Organic cation transmembrane transporter activity	TAS
GO:0015125	Function	Bile acid transmembrane transporter activity	IBA
GO:0015125	Function	Bile acid transmembrane transporter activity	TAS
GO:0015347	Function	Sodium-independent organic anion transmembrane transporter activity	IBA
GO:0015695	Process	Organic cation transport	IEA
GO:0015711	Process	Organic anion transport	TAS	9007731
GO:0015721	Process	Bile acid and bile salt transport	IBA
GO:0015721	Process	Bile acid and bile salt transport	TAS
GO:0016020	Component	Membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	TAS
GO:0022857	Function	Transmembrane transporter activity	IDA	25132355
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0043252	Process	Sodium-independent organic anion transport	IBA
GO:0043252	Process	Sodium-independent organic anion transport	TAS
GO:0055085	Process	Transmembrane transport	IEA

MIM	HGNC	e!Ensembl
602883	10956	ENSG00000084453

P46721

Protein name

Solute carrier organic anion transporter family member 1A2 (OATP1A2) (OATP-A) (Organic anion-transporting polypeptide 1) (OATP-1) (Sodium-independent organic anion transporter) (Solute carrier family 21 member 3)

Protein function

Na(+)-independent transporter that mediates the cellular uptake of a broad range of organic anions such as the endogenous bile salts cholate and deoxycholate, either in their unconjugated or conjugated forms (taurocholate and glycocholate), at t

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF03137	OATP	21 → 597	Organic Anion Transporter Polypeptide (OATP) family	Family
PF07648	Kazal_2	440 → 486	Kazal-type serine protease inhibitor domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Higher expression in the brain than in liver and kidney (PubMed:15632119, PubMed:7557095, PubMed:9539145). Expressed in brain neurons in both cortex and hippocampus (PubMed:10873595, PubMed:25132355). Expressed in placental trophoblast

Sequence

MGETEKRIETHRIRCLSKLKMFLLAITCAFVSKTLSGSYMNSMLTQIERQFNIPTSLVGF
INGSFEIGNLLLIIFVSYFGTKLHRPIMIGIGCVVMGLGCFLKSLPHFLMNQYEYESTVS
VSGNLSSNSFLCMENGTQILRPTQDPSECTKEVKSLMWVYVLVGNIVRGMGETPILPLGI
SYIEDFAKFENSPLYIGLVETGAIIGPLIGLLLASFCANVYVDTGFVNTDDLIITPTDTR
WVGAWWFGFLICAGVNVLTAIPFFFLPNTLPKEGLETNADIIKNENEDKQKEEVKKEKYG
ITKDFLPFMKSLSCNPIYMLFILVSVIQFNAFVNMISFMPKYLEQQYGISSSDAIFLMGI
YNLPPICIGYIIGGLIMKKFKITVKQAAHIGCWLSLLEYLLYFLSFLMTCENSSVVGINT
SYEGIPQDLYVENDIFADCNVDCNCPSKIWDPVCGNNGLSYLSACLAGCETSIGTGINMV
FQNCSCIQTSGNSSAVLGLCDKGPDCSLMLQYFLILSAMSSFIYSLAAIPGYMVLLRCMK
SEEKSLGVGLHTFCTRVFAGIPAPIYFGALMDSTCLHWGTLKCGESGACRIYDSTTFRYI
YLGLPAALRGSSFVPALIILILLRKCHLPGENASSGTELIETKVKGKENECKDIYQKSTV
LKDDELKTKL

Sequence length

670

Interactions

View interactions

	KEGG		Reactome
	Bile secretion		Recycling of bile acids and salts Transport of organic anions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHOLESTASIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROGRESSIVE SUPRANUCLEAR PALSY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (43)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	29306656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	29306656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	26146896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	26146896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile Duct Diseases	Bile duct disease	Pubtator	28084414	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	28928160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16397270, 18948755, 19010908, 21278488, 25924632, 26318989, 28388363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19010908	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21278488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	21383546, 23142319	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	29306656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	20837016, 26146896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	20837016, 26146896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	26146896	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholestasis of pregnancy	Cholestasis of pregnancy	BEFREE	19882051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	27021820	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	37543674	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	23018631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	24613363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallstones	Gallstones	Pubtator	26146896, 32597704	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperbilirubinemia	Hyperbilirubinemia	BEFREE	28063966		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	31509975		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19010908, 21278488, 25924632, 26318989, 28388363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22864060, 30890759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25735612, 30372058		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	19010908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22588260		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	30348897		★★★★★ ★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	22509823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	21633340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25611302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nervous System Diseases	Nervous system disease	Pubtator	37174648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	24613363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	29306656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progressive supranuclear palsy	Progressive Supranuclear Palsy	GWASCAT_DG	21685912, 30089514		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy	Progressive Supranuclear Palsy	GWASDB_DG	21685912		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive supranuclear palsy	Progressive Supranuclear Palsy	BEFREE	22685416, 29986742		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	22864060, 30890759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22864060, 30890759	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23137910	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	23137910		★★★★★ ★☆☆☆☆ Found in Text Mining only
Supranuclear Palsy Progressive	Progressive supranuclear palsy	Pubtator	29986742, 30089514, 35842134, 39251599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLCO1A2 (solute carrier organic anion transporter family member 1A2)