SLC17A1 (solute carrier family 17 member 1)

Gene

• Entrez ID: 6568
• Gene name: Solute carrier family 17 member 1
• Gene symbol: SLC17A1
• Synonyms (NCBI Gene): NAPI-1, NPT-1, NPT1
• Chromosome: 6
• Chromosome location: 6p22.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT019052	hsa-miR-335-5p	Microarray	18185580
MIRT1353386	hsa-miR-1915	CLIP-seq
MIRT1353387	hsa-miR-2276	CLIP-seq
MIRT1353388	hsa-miR-302a	CLIP-seq
MIRT1353389	hsa-miR-302b	CLIP-seq
MIRT1353390	hsa-miR-302c	CLIP-seq
MIRT1353391	hsa-miR-302d	CLIP-seq
MIRT1353392	hsa-miR-302e	CLIP-seq
MIRT1353393	hsa-miR-3155	CLIP-seq
MIRT1353394	hsa-miR-3155b	CLIP-seq
MIRT1353395	hsa-miR-3194-3p	CLIP-seq
MIRT1353396	hsa-miR-372	CLIP-seq
MIRT1353397	hsa-miR-373	CLIP-seq
MIRT1353398	hsa-miR-3942-3p	CLIP-seq
MIRT1353399	hsa-miR-4666-5p	CLIP-seq
MIRT1353400	hsa-miR-4726-3p	CLIP-seq
MIRT1353401	hsa-miR-4772-3p	CLIP-seq
MIRT1353402	hsa-miR-484	CLIP-seq
MIRT1353403	hsa-miR-520a-3p	CLIP-seq
MIRT1353404	hsa-miR-520b	CLIP-seq
MIRT1353405	hsa-miR-520c-3p	CLIP-seq
MIRT1353406	hsa-miR-520d-3p	CLIP-seq
MIRT1353407	hsa-miR-520e	CLIP-seq
MIRT1353408	hsa-miR-656	CLIP-seq
MIRT1353409	hsa-miR-760	CLIP-seq
MIRT2459500	hsa-miR-138	CLIP-seq
MIRT2459501	hsa-miR-3607-5p	CLIP-seq
MIRT2459502	hsa-miR-4281	CLIP-seq
MIRT2459500	hsa-miR-138	CLIP-seq
MIRT2459501	hsa-miR-3607-5p	CLIP-seq
MIRT2459502	hsa-miR-4281	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005315	Function	Phosphate transmembrane transporter activity	IEA
GO:0005436	Function	Sodium:phosphate symporter activity	IEA
GO:0005436	Function	Sodium:phosphate symporter activity	TAS	8867793
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	8288239
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006814	Process	Sodium ion transport	IEA
GO:0006817	Process	Phosphate ion transport	TAS	8867793
GO:0015293	Function	Symporter activity	IEA
GO:0015747	Process	Urate transport	IBA
GO:0015747	Process	Urate transport	IMP	25252215, 27906618
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8288239
GO:0016324	Component	Apical plasma membrane	IBA
GO:0016324	Component	Apical plasma membrane	IDA	25252215, 27906618
GO:0016324	Component	Apical plasma membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IBA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035435	Process	Phosphate ion transmembrane transport	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0044341	Process	Sodium-dependent phosphate transport	IBA
GO:0044341	Process	Sodium-dependent phosphate transport	IDA	7826357
GO:0046415	Process	Urate metabolic process	IMP	19503597
GO:0055085	Process	Transmembrane transport	IEA

Other IDs

• MIM: 182308
• HGNC: 10929
• e!Ensembl: ENSG00000124568

Protein

• UniProt ID: Q14916
• Protein name: Sodium-dependent phosphate transport protein 1 (Na(+)/PI cotransporter 1) (Na/Pi-4) (Renal Na(+)-dependent phosphate cotransporter 1) (Renal sodium-dependent phosphate transport protein 1) (Renal sodium-phosphate transport protein 1) (Sodium/phosphate cot
• Protein function: Important for the resorption of phosphate by the kidney (PubMed:7826357). May be involved in actively transporting phosphate into cells via Na(+) cotransport in the renal brush border membrane (PubMed:7826357). Plays a role in urate transport in
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07690	MFS_1	26 → 410	Major Facilitator Superfamily	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in kidney cortex, liver and brain but not in other tissues. {ECO:0000269|PubMed:7826357}.
• Sequence:

  MQMDNRLPPKKVPGFCSFRYGLSFLVHCCNVIITAQRACLNLTMVVMVNSTDPHGLPNTS
  TKKLLDNIKNPMYNWSPDIQGIILSSTSYGVIIIQVPVGYFSGIYSTKKMIGFALCLSSV
  LSLLIPPAAGIGVAWVVVCRAVQGAAQGIVATAQFEIYVKWAPPLERGRLTSMSTSGFLL
  GPFIVLLVTGVICESLGWPMVFYIFGACGCAVCLLWFVLFYDDPKDHPCISISEKEYITS
  SLVQQVSSSRQSLPIKAILKSLPVWAISTGSFTFFWSHNIMTLYTPMFINSMLHVNIKEN
  GFLSSLPYLFAWICGNLAGQLSDFFLTRNILSVIAVRKLFTAAGFLLPAIFGVCLPYLSS
  TFYSIVIFLILAGATGSFCLGGVFINGLDIAPRYFGFIKACSTLTGMIGGLIASTLTGLI
  LKQDPESAWFKTFILMAAINVTGLIFYLIVATAEIQDWAKEKQHTRL

• Sequence length: 467

Pathways

Reactome:

Organic anion transporters

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CELIAC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DENTAL CARIES	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IRRITABLE BOWEL SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	20884846, 21768215, 23263486		★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	26290326		★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	GWASCAT_DG	27899376, 31578528		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	37696853	Associate	★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	20884846, 21768215, 23263486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	Pubtator	22541845, 26290326, 38222853	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gout	Gout	GWASCAT_DG	27899376, 31578528		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	26524967		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	Pubtator	32375679, 38222853	Associate	★☆☆☆☆ Found in Text Mining only
Hypophosphatemic Rickets, X-Linked Dominant	Hypophosphatemic Rickets	BEFREE	8047391		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	32375679	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23936189		★☆☆☆☆ Found in Text Mining only
Polycystic kidney disease, type 2	Polycystic kidney disease	BEFREE	22609445		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	GWASDB_DG	19571809		★☆☆☆☆ Found in Text Mining only
Vitamin D-Resistant Rickets, X-Linked	Vitamin D-Dependent Rickets	BEFREE	8047391		★☆☆☆☆ Found in Text Mining only