Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6566
Gene name	Solute carrier family 16 member 1
Gene symbol	SLC16A1
Synonyms (NCBI Gene)	HHF7MCTMCT1MCT1D
Chromosome	1
Chromosome location	1p13.2
Summary	The protein encoded by this gene is a proton-linked monocarboxylate transporter that catalyzes the movement of many monocarboxylates, such as lactate and pyruvate, across the plasma membrane. Mutations in this gene are associated with erythrocyte lactate

Show/Hide all (11)

SNP ID	Visualize variation	Clinical significance	Consequence
rs72552271	C>T	Uncertain-significance, pathogenic	Missense variant, coding sequence variant
rs80358222	T>C	Pathogenic	Missense variant, coding sequence variant
rs606231299	G>A,T	Pathogenic	Stop gained, coding sequence variant, synonymous variant
rs606231300	G>A	Pathogenic	Stop gained, coding sequence variant
rs606231301	C>-	Pathogenic	Coding sequence variant, frameshift variant
rs606231302	C>T	Pathogenic	Coding sequence variant, missense variant
rs606231309	G>-,GG	Pathogenic	Coding sequence variant, frameshift variant
rs606231310	G>A	Pathogenic	Stop gained, coding sequence variant
rs606231311	AATT>-	Pathogenic	Coding sequence variant, frameshift variant
rs606231312	->G	Pathogenic	Coding sequence variant, frameshift variant
rs1570619302	G>-	Likely-pathogenic	Coding sequence variant, frameshift variant

483

Show/Hide all (483)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002665	hsa-miR-124-3p	Luciferase reporter assayWestern blot	19427019
MIRT002665	hsa-miR-124-3p	Luciferase reporter assayWestern blot	19427019
MIRT001745	hsa-miR-376a-5p	Luciferase reporter assay	17322061
MIRT001745	hsa-miR-376a-5p	Luciferase reporter assay	17322061
MIRT002665	hsa-miR-124-3p	MicroarrayqRT-PCR	16549876
MIRT002665	hsa-miR-124-3p	Microarray	15685193
MIRT016624	hsa-miR-484	Sequencing	20371350
MIRT019664	hsa-miR-376a-3p	Reporter assay	17322061
MIRT021959	hsa-miR-128-3p	Microarray	17612493
MIRT002665	hsa-miR-124-3p	Microarray	18668037
MIRT002665	hsa-miR-124-3p	Reporter assay;Western blot;qRT-PCR	19427019
MIRT002665	hsa-miR-124-3p	qRT-PCR	16549876
MIRT046336	hsa-miR-23b-3p	CLASH	23622248
MIRT044631	hsa-miR-320a	CLASH	23622248
MIRT040070	hsa-miR-615-3p	CLASH	23622248
MIRT630801	hsa-miR-890	HITS-CLIP	19536157
MIRT630800	hsa-miR-6815-3p	HITS-CLIP	19536157
MIRT630799	hsa-miR-6792-5p	HITS-CLIP	19536157
MIRT630798	hsa-miR-4503	HITS-CLIP	19536157
MIRT710074	hsa-miR-302c-5p	HITS-CLIP	19536157
MIRT241355	hsa-miR-552-5p	HITS-CLIP	19536157
MIRT674754	hsa-miR-1267	HITS-CLIP	23824327
MIRT674753	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT674752	hsa-miR-924	HITS-CLIP	23824327
MIRT674751	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT674750	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT674749	hsa-miR-4294	HITS-CLIP	23824327
MIRT674748	hsa-miR-431-5p	HITS-CLIP	23824327
MIRT674747	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT674746	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT674745	hsa-miR-3672	HITS-CLIP	23824327
MIRT674744	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT674743	hsa-miR-1202	HITS-CLIP	23824327
MIRT674742	hsa-miR-3972	HITS-CLIP	23824327
MIRT674741	hsa-miR-5006-5p	HITS-CLIP	23824327
MIRT674740	hsa-miR-5691	HITS-CLIP	23824327
MIRT674739	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT674738	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT674737	hsa-miR-8055	HITS-CLIP	23824327
MIRT332037	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT630801	hsa-miR-890	HITS-CLIP	23824327
MIRT630800	hsa-miR-6815-3p	HITS-CLIP	23824327
MIRT630799	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT630798	hsa-miR-4503	HITS-CLIP	23824327
MIRT241358	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT241363	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT002665	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT505637	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT505636	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT505635	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT505634	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT505633	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT505631	hsa-miR-5582-3p	PAR-CLIP	20371350
MIRT505632	hsa-miR-3714	PAR-CLIP	20371350
MIRT505630	hsa-miR-3910	PAR-CLIP	20371350
MIRT505629	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT505628	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT565640	hsa-miR-425-5p	PAR-CLIP	20371350
MIRT565639	hsa-miR-3117-5p	PAR-CLIP	20371350
MIRT565638	hsa-miR-548m	PAR-CLIP	20371350
MIRT565637	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT565636	hsa-miR-6814-5p	PAR-CLIP	20371350
MIRT565635	hsa-miR-4324	PAR-CLIP	20371350
MIRT565634	hsa-miR-6761-5p	PAR-CLIP	20371350
MIRT565633	hsa-miR-1914-3p	PAR-CLIP	20371350
MIRT565632	hsa-miR-5194	PAR-CLIP	20371350
MIRT565631	hsa-miR-6738-5p	PAR-CLIP	20371350
MIRT565630	hsa-miR-380-5p	PAR-CLIP	20371350
MIRT565629	hsa-miR-563	PAR-CLIP	20371350
MIRT565628	hsa-miR-576-5p	PAR-CLIP	20371350
MIRT561582	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT565627	hsa-miR-4307	PAR-CLIP	20371350
MIRT561581	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT265226	hsa-miR-302a-5p	PAR-CLIP	20371350
MIRT561580	hsa-miR-3148	PAR-CLIP	20371350
MIRT561579	hsa-miR-6124	PAR-CLIP	20371350
MIRT332051	hsa-miR-3978	PAR-CLIP	20371350
MIRT561582	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT561581	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT265226	hsa-miR-302a-5p	PAR-CLIP	20371350
MIRT561580	hsa-miR-3148	PAR-CLIP	20371350
MIRT561579	hsa-miR-6124	PAR-CLIP	20371350
MIRT332051	hsa-miR-3978	PAR-CLIP	20371350
MIRT467971	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT467970	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT467969	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT467968	hsa-miR-4438	PAR-CLIP	21572407
MIRT467967	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT467966	hsa-miR-1972	PAR-CLIP	21572407
MIRT467965	hsa-miR-936	PAR-CLIP	21572407
MIRT467960	hsa-miR-3663-3p	PAR-CLIP	21572407
MIRT467959	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT467958	hsa-miR-3529-5p	PAR-CLIP	21572407
MIRT467957	hsa-miR-379-5p	PAR-CLIP	21572407
MIRT467956	hsa-miR-4451	PAR-CLIP	21572407
MIRT467955	hsa-miR-376a-2-5p	PAR-CLIP	21572407
MIRT467954	hsa-miR-5095	PAR-CLIP	21572407
MIRT467953	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT265218	hsa-miR-33a-5p	PAR-CLIP	21572407
MIRT265221	hsa-miR-33b-5p	PAR-CLIP	21572407
MIRT467944	hsa-miR-3680-3p	PAR-CLIP	21572407
MIRT241358	hsa-miR-374a-5p	PAR-CLIP	22012620
MIRT241363	hsa-miR-374b-5p	PAR-CLIP	22012620
MIRT002665	hsa-miR-124-3p	PAR-CLIP	22012620
MIRT505638	hsa-miR-506-3p	PAR-CLIP	22012620
MIRT002665	hsa-miR-124-3p	PAR-CLIP	22012620
MIRT505637	hsa-miR-548a-3p	PAR-CLIP	22012620
MIRT505636	hsa-miR-548ar-3p	PAR-CLIP	22012620
MIRT505635	hsa-miR-548az-3p	PAR-CLIP	22012620
MIRT505634	hsa-miR-548e-3p	PAR-CLIP	22012620
MIRT505633	hsa-miR-548f-3p	PAR-CLIP	22012620
MIRT505631	hsa-miR-5582-3p	PAR-CLIP	22012620
MIRT505632	hsa-miR-3714	PAR-CLIP	22012620
MIRT505630	hsa-miR-3910	PAR-CLIP	22012620
MIRT505629	hsa-miR-5582-5p	PAR-CLIP	22012620
MIRT505628	hsa-miR-656-3p	PAR-CLIP	22012620
MIRT534249	hsa-miR-605-5p	PAR-CLIP	22012620
MIRT534248	hsa-miR-7109-3p	PAR-CLIP	22012620
MIRT265246	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT058706	hsa-miR-6074	PAR-CLIP	22012620
MIRT534247	hsa-miR-188-5p	PAR-CLIP	22012620
MIRT534246	hsa-miR-6866-3p	PAR-CLIP	22012620
MIRT534245	hsa-miR-892c-5p	PAR-CLIP	22012620
MIRT534244	hsa-miR-506-5p	PAR-CLIP	22012620
MIRT265243	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT241358	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT241363	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT002665	hsa-miR-124-3p	PAR-CLIP	23446348
MIRT505638	hsa-miR-506-3p	PAR-CLIP	23446348
MIRT002665	hsa-miR-124-3p	PAR-CLIP	23446348
MIRT505637	hsa-miR-548a-3p	PAR-CLIP	23446348
MIRT505636	hsa-miR-548ar-3p	PAR-CLIP	23446348
MIRT505635	hsa-miR-548az-3p	PAR-CLIP	23446348
MIRT505634	hsa-miR-548e-3p	PAR-CLIP	23446348
MIRT505633	hsa-miR-548f-3p	PAR-CLIP	23446348
MIRT505631	hsa-miR-5582-3p	PAR-CLIP	23446348
MIRT505632	hsa-miR-3714	PAR-CLIP	23446348
MIRT505630	hsa-miR-3910	PAR-CLIP	23446348
MIRT505629	hsa-miR-5582-5p	PAR-CLIP	23446348
MIRT505628	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT241358	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT241363	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT002665	hsa-miR-124-3p	PAR-CLIP	23446348
MIRT505638	hsa-miR-506-3p	PAR-CLIP	23446348
MIRT002665	hsa-miR-124-3p	PAR-CLIP	23446348
MIRT505637	hsa-miR-548a-3p	PAR-CLIP	23446348
MIRT505636	hsa-miR-548ar-3p	PAR-CLIP	23446348
MIRT505635	hsa-miR-548az-3p	PAR-CLIP	23446348
MIRT505634	hsa-miR-548e-3p	PAR-CLIP	23446348
MIRT505633	hsa-miR-548f-3p	PAR-CLIP	23446348
MIRT505631	hsa-miR-5582-3p	PAR-CLIP	23446348
MIRT505632	hsa-miR-3714	PAR-CLIP	23446348
MIRT505630	hsa-miR-3910	PAR-CLIP	23446348
MIRT505629	hsa-miR-5582-5p	PAR-CLIP	23446348
MIRT505628	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT467971	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT467970	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT467969	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT467968	hsa-miR-4438	PAR-CLIP	23592263
MIRT467967	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT467966	hsa-miR-1972	PAR-CLIP	23592263
MIRT467965	hsa-miR-936	PAR-CLIP	23592263
MIRT467964	hsa-miR-8060	PAR-CLIP	23592263
MIRT467963	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT467962	hsa-miR-6852-5p	PAR-CLIP	23592263
MIRT467961	hsa-miR-6742-3p	PAR-CLIP	23592263
MIRT467960	hsa-miR-3663-3p	PAR-CLIP	23592263
MIRT467959	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT467958	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT467957	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT467956	hsa-miR-4451	PAR-CLIP	23592263
MIRT467955	hsa-miR-376a-2-5p	PAR-CLIP	23592263
MIRT467954	hsa-miR-5095	PAR-CLIP	23592263
MIRT467953	hsa-miR-7151-3p	PAR-CLIP	23592263
MIRT467952	hsa-miR-5100	PAR-CLIP	23592263
MIRT467951	hsa-miR-7154-5p	PAR-CLIP	23592263
MIRT467950	hsa-miR-1343-3p	PAR-CLIP	23592263
MIRT467949	hsa-miR-6783-3p	PAR-CLIP	23592263
MIRT467948	hsa-miR-3942-3p	PAR-CLIP	23592263
MIRT467947	hsa-miR-30a-3p	PAR-CLIP	23592263
MIRT467946	hsa-miR-30d-3p	PAR-CLIP	23592263
MIRT467945	hsa-miR-30e-3p	PAR-CLIP	23592263
MIRT467944	hsa-miR-3680-3p	PAR-CLIP	23592263
MIRT467943	hsa-miR-3936	PAR-CLIP	23592263
MIRT058696	hsa-miR-5003-3p	PAR-CLIP	23592263
MIRT467942	hsa-miR-4719	PAR-CLIP	23592263
MIRT467941	hsa-miR-5681a	PAR-CLIP	23592263
MIRT467940	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT467939	hsa-miR-488-3p	PAR-CLIP	23592263
MIRT021959	hsa-miR-128-3p	PAR-CLIP	26701625
MIRT561580	hsa-miR-3148	PAR-CLIP	26701625
MIRT332051	hsa-miR-3978	PAR-CLIP	26701625
MIRT505631	hsa-miR-5582-3p	PAR-CLIP	26701625
MIRT561579	hsa-miR-6124	PAR-CLIP	26701625
MIRT630801	hsa-miR-890	HITS-CLIP	19536157
MIRT630800	hsa-miR-6815-3p	HITS-CLIP	19536157
MIRT630799	hsa-miR-6792-5p	HITS-CLIP	19536157
MIRT630798	hsa-miR-4503	HITS-CLIP	19536157
MIRT710074	hsa-miR-302c-5p	HITS-CLIP	19536157
MIRT241355	hsa-miR-552-5p	HITS-CLIP	19536157
MIRT674754	hsa-miR-1267	HITS-CLIP	23824327
MIRT674753	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT674752	hsa-miR-924	HITS-CLIP	23824327
MIRT674751	hsa-miR-4755-3p	HITS-CLIP	23824327
MIRT674750	hsa-miR-3194-3p	HITS-CLIP	23824327
MIRT674749	hsa-miR-4294	HITS-CLIP	23824327
MIRT674748	hsa-miR-431-5p	HITS-CLIP	23824327
MIRT674747	hsa-miR-6501-5p	HITS-CLIP	23824327
MIRT674746	hsa-miR-4423-5p	HITS-CLIP	23824327
MIRT674745	hsa-miR-3672	HITS-CLIP	23824327
MIRT674744	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT674743	hsa-miR-1202	HITS-CLIP	23824327
MIRT674742	hsa-miR-3972	HITS-CLIP	23824327
MIRT674741	hsa-miR-5006-5p	HITS-CLIP	23824327
MIRT674740	hsa-miR-5691	HITS-CLIP	23824327
MIRT674739	hsa-miR-6805-3p	HITS-CLIP	23824327
MIRT674738	hsa-miR-744-3p	HITS-CLIP	23824327
MIRT674737	hsa-miR-8055	HITS-CLIP	23824327
MIRT332037	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT630801	hsa-miR-890	HITS-CLIP	23824327
MIRT630800	hsa-miR-6815-3p	HITS-CLIP	23824327
MIRT630799	hsa-miR-6792-5p	HITS-CLIP	23824327
MIRT630798	hsa-miR-4503	HITS-CLIP	23824327
MIRT241358	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT241363	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT002665	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT505637	hsa-miR-548a-3p	PAR-CLIP	20371350
MIRT505636	hsa-miR-548ar-3p	PAR-CLIP	20371350
MIRT505635	hsa-miR-548az-3p	PAR-CLIP	20371350
MIRT505634	hsa-miR-548e-3p	PAR-CLIP	20371350
MIRT505633	hsa-miR-548f-3p	PAR-CLIP	20371350
MIRT505631	hsa-miR-5582-3p	PAR-CLIP	20371350
MIRT505632	hsa-miR-3714	PAR-CLIP	20371350
MIRT505630	hsa-miR-3910	PAR-CLIP	20371350
MIRT505629	hsa-miR-5582-5p	PAR-CLIP	20371350
MIRT505628	hsa-miR-656-3p	PAR-CLIP	20371350
MIRT565640	hsa-miR-425-5p	PAR-CLIP	20371350
MIRT565639	hsa-miR-3117-5p	PAR-CLIP	20371350
MIRT565638	hsa-miR-548m	PAR-CLIP	20371350
MIRT565637	hsa-miR-4733-5p	PAR-CLIP	20371350
MIRT565636	hsa-miR-6814-5p	PAR-CLIP	20371350
MIRT565635	hsa-miR-4324	PAR-CLIP	20371350
MIRT565634	hsa-miR-6761-5p	PAR-CLIP	20371350
MIRT565633	hsa-miR-1914-3p	PAR-CLIP	20371350
MIRT565632	hsa-miR-5194	PAR-CLIP	20371350
MIRT565631	hsa-miR-6738-5p	PAR-CLIP	20371350
MIRT565630	hsa-miR-380-5p	PAR-CLIP	20371350
MIRT565629	hsa-miR-563	PAR-CLIP	20371350
MIRT565628	hsa-miR-576-5p	PAR-CLIP	20371350
MIRT561582	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT565627	hsa-miR-4307	PAR-CLIP	20371350
MIRT561581	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT265226	hsa-miR-302a-5p	PAR-CLIP	20371350
MIRT561580	hsa-miR-3148	PAR-CLIP	20371350
MIRT561579	hsa-miR-6124	PAR-CLIP	20371350
MIRT332051	hsa-miR-3978	PAR-CLIP	20371350
MIRT561582	hsa-miR-33a-3p	PAR-CLIP	20371350
MIRT561581	hsa-miR-5002-5p	PAR-CLIP	20371350
MIRT265226	hsa-miR-302a-5p	PAR-CLIP	20371350
MIRT561580	hsa-miR-3148	PAR-CLIP	20371350
MIRT561579	hsa-miR-6124	PAR-CLIP	20371350
MIRT332051	hsa-miR-3978	PAR-CLIP	20371350
MIRT467971	hsa-miR-29b-3p	PAR-CLIP	21572407
MIRT467970	hsa-miR-29c-3p	PAR-CLIP	21572407
MIRT467969	hsa-miR-29a-3p	PAR-CLIP	21572407
MIRT467968	hsa-miR-4438	PAR-CLIP	21572407
MIRT467967	hsa-miR-6504-3p	PAR-CLIP	21572407
MIRT467966	hsa-miR-1972	PAR-CLIP	21572407
MIRT467965	hsa-miR-936	PAR-CLIP	21572407
MIRT467960	hsa-miR-3663-3p	PAR-CLIP	21572407
MIRT467959	hsa-miR-4650-3p	PAR-CLIP	21572407
MIRT467958	hsa-miR-3529-5p	PAR-CLIP	21572407
MIRT467957	hsa-miR-379-5p	PAR-CLIP	21572407
MIRT467956	hsa-miR-4451	PAR-CLIP	21572407
MIRT467955	hsa-miR-376a-2-5p	PAR-CLIP	21572407
MIRT467954	hsa-miR-5095	PAR-CLIP	21572407
MIRT467953	hsa-miR-7151-3p	PAR-CLIP	21572407
MIRT265218	hsa-miR-33a-5p	PAR-CLIP	21572407
MIRT265221	hsa-miR-33b-5p	PAR-CLIP	21572407
MIRT467944	hsa-miR-3680-3p	PAR-CLIP	21572407
MIRT241358	hsa-miR-374a-5p	PAR-CLIP	22012620
MIRT241363	hsa-miR-374b-5p	PAR-CLIP	22012620
MIRT002665	hsa-miR-124-3p	PAR-CLIP	22012620
MIRT505638	hsa-miR-506-3p	PAR-CLIP	22012620
MIRT002665	hsa-miR-124-3p	PAR-CLIP	22012620
MIRT505637	hsa-miR-548a-3p	PAR-CLIP	22012620
MIRT505636	hsa-miR-548ar-3p	PAR-CLIP	22012620
MIRT505635	hsa-miR-548az-3p	PAR-CLIP	22012620
MIRT505634	hsa-miR-548e-3p	PAR-CLIP	22012620
MIRT505633	hsa-miR-548f-3p	PAR-CLIP	22012620
MIRT505631	hsa-miR-5582-3p	PAR-CLIP	22012620
MIRT505632	hsa-miR-3714	PAR-CLIP	22012620
MIRT505630	hsa-miR-3910	PAR-CLIP	22012620
MIRT505629	hsa-miR-5582-5p	PAR-CLIP	22012620
MIRT505628	hsa-miR-656-3p	PAR-CLIP	22012620
MIRT534249	hsa-miR-605-5p	PAR-CLIP	22012620
MIRT534248	hsa-miR-7109-3p	PAR-CLIP	22012620
MIRT265246	hsa-miR-5011-5p	PAR-CLIP	22012620
MIRT058706	hsa-miR-6074	PAR-CLIP	22012620
MIRT534247	hsa-miR-188-5p	PAR-CLIP	22012620
MIRT534246	hsa-miR-6866-3p	PAR-CLIP	22012620
MIRT534245	hsa-miR-892c-5p	PAR-CLIP	22012620
MIRT534244	hsa-miR-506-5p	PAR-CLIP	22012620
MIRT265243	hsa-miR-190a-3p	PAR-CLIP	22012620
MIRT241358	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT241363	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT002665	hsa-miR-124-3p	PAR-CLIP	23446348
MIRT505638	hsa-miR-506-3p	PAR-CLIP	23446348
MIRT002665	hsa-miR-124-3p	PAR-CLIP	23446348
MIRT505637	hsa-miR-548a-3p	PAR-CLIP	23446348
MIRT505636	hsa-miR-548ar-3p	PAR-CLIP	23446348
MIRT505635	hsa-miR-548az-3p	PAR-CLIP	23446348
MIRT505634	hsa-miR-548e-3p	PAR-CLIP	23446348
MIRT505633	hsa-miR-548f-3p	PAR-CLIP	23446348
MIRT505631	hsa-miR-5582-3p	PAR-CLIP	23446348
MIRT505632	hsa-miR-3714	PAR-CLIP	23446348
MIRT505630	hsa-miR-3910	PAR-CLIP	23446348
MIRT505629	hsa-miR-5582-5p	PAR-CLIP	23446348
MIRT505628	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT241358	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT241363	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT002665	hsa-miR-124-3p	PAR-CLIP	23446348
MIRT505638	hsa-miR-506-3p	PAR-CLIP	23446348
MIRT002665	hsa-miR-124-3p	PAR-CLIP	23446348
MIRT505637	hsa-miR-548a-3p	PAR-CLIP	23446348
MIRT505636	hsa-miR-548ar-3p	PAR-CLIP	23446348
MIRT505635	hsa-miR-548az-3p	PAR-CLIP	23446348
MIRT505634	hsa-miR-548e-3p	PAR-CLIP	23446348
MIRT505633	hsa-miR-548f-3p	PAR-CLIP	23446348
MIRT505631	hsa-miR-5582-3p	PAR-CLIP	23446348
MIRT505632	hsa-miR-3714	PAR-CLIP	23446348
MIRT505630	hsa-miR-3910	PAR-CLIP	23446348
MIRT505629	hsa-miR-5582-5p	PAR-CLIP	23446348
MIRT505628	hsa-miR-656-3p	PAR-CLIP	23446348
MIRT467971	hsa-miR-29b-3p	PAR-CLIP	23592263
MIRT467970	hsa-miR-29c-3p	PAR-CLIP	23592263
MIRT467969	hsa-miR-29a-3p	PAR-CLIP	23592263
MIRT467968	hsa-miR-4438	PAR-CLIP	23592263
MIRT467967	hsa-miR-6504-3p	PAR-CLIP	23592263
MIRT467966	hsa-miR-1972	PAR-CLIP	23592263
MIRT467965	hsa-miR-936	PAR-CLIP	23592263
MIRT467964	hsa-miR-8060	PAR-CLIP	23592263
MIRT467963	hsa-miR-939-3p	PAR-CLIP	23592263
MIRT467962	hsa-miR-6852-5p	PAR-CLIP	23592263
MIRT467961	hsa-miR-6742-3p	PAR-CLIP	23592263
MIRT467960	hsa-miR-3663-3p	PAR-CLIP	23592263
MIRT467959	hsa-miR-4650-3p	PAR-CLIP	23592263
MIRT467958	hsa-miR-3529-5p	PAR-CLIP	23592263
MIRT467957	hsa-miR-379-5p	PAR-CLIP	23592263
MIRT467956	hsa-miR-4451	PAR-CLIP	23592263
MIRT467955	hsa-miR-376a-2-5p	PAR-CLIP	23592263
MIRT467954	hsa-miR-5095	PAR-CLIP	23592263
MIRT467953	hsa-miR-7151-3p	PAR-CLIP	23592263
MIRT467952	hsa-miR-5100	PAR-CLIP	23592263
MIRT467951	hsa-miR-7154-5p	PAR-CLIP	23592263
MIRT467950	hsa-miR-1343-3p	PAR-CLIP	23592263
MIRT467949	hsa-miR-6783-3p	PAR-CLIP	23592263
MIRT467948	hsa-miR-3942-3p	PAR-CLIP	23592263
MIRT467947	hsa-miR-30a-3p	PAR-CLIP	23592263
MIRT467946	hsa-miR-30d-3p	PAR-CLIP	23592263
MIRT467945	hsa-miR-30e-3p	PAR-CLIP	23592263
MIRT467944	hsa-miR-3680-3p	PAR-CLIP	23592263
MIRT467943	hsa-miR-3936	PAR-CLIP	23592263
MIRT058696	hsa-miR-5003-3p	PAR-CLIP	23592263
MIRT467942	hsa-miR-4719	PAR-CLIP	23592263
MIRT467941	hsa-miR-5681a	PAR-CLIP	23592263
MIRT467940	hsa-miR-6730-5p	PAR-CLIP	23592263
MIRT467939	hsa-miR-488-3p	PAR-CLIP	23592263
MIRT1352846	hsa-miR-1238	CLIP-seq
MIRT1352847	hsa-miR-128	CLIP-seq
MIRT1352848	hsa-miR-27a	CLIP-seq
MIRT1352849	hsa-miR-27b	CLIP-seq
MIRT1352850	hsa-miR-3120-3p	CLIP-seq
MIRT1352851	hsa-miR-323b-3p	CLIP-seq
MIRT1352852	hsa-miR-3613-5p	CLIP-seq
MIRT1352853	hsa-miR-3618	CLIP-seq
MIRT1352854	hsa-miR-3942-5p	CLIP-seq
MIRT1352855	hsa-miR-4468	CLIP-seq
MIRT1352856	hsa-miR-4699-3p	CLIP-seq
MIRT1352857	hsa-miR-4703-5p	CLIP-seq
MIRT1352858	hsa-miR-4735-5p	CLIP-seq
MIRT1352859	hsa-miR-576-3p	CLIP-seq
MIRT1352860	hsa-miR-934	CLIP-seq
MIRT1352861	hsa-miR-939	CLIP-seq
MIRT1352862	hsa-miR-125a-3p	CLIP-seq
MIRT1352863	hsa-miR-324-5p	CLIP-seq
MIRT1352864	hsa-miR-34a	CLIP-seq
MIRT1352865	hsa-miR-34c-5p	CLIP-seq
MIRT1352866	hsa-miR-3613-3p	CLIP-seq
MIRT1352867	hsa-miR-4436b-3p	CLIP-seq
MIRT1352868	hsa-miR-449a	CLIP-seq
MIRT1352869	hsa-miR-449b	CLIP-seq
MIRT1352870	hsa-miR-607	CLIP-seq
MIRT2104478	hsa-miR-4649-3p	CLIP-seq
MIRT1352852	hsa-miR-3613-5p	CLIP-seq
MIRT1352856	hsa-miR-4699-3p	CLIP-seq
MIRT1352859	hsa-miR-576-3p	CLIP-seq
MIRT2328905	hsa-miR-4684-5p	CLIP-seq
MIRT2328906	hsa-miR-4768-5p	CLIP-seq
MIRT2328907	hsa-miR-891b	CLIP-seq
MIRT2623281	hsa-miR-1236	CLIP-seq
MIRT2623282	hsa-miR-1245b-5p	CLIP-seq
MIRT2623283	hsa-miR-1322	CLIP-seq
MIRT2623284	hsa-miR-141	CLIP-seq
MIRT2623285	hsa-miR-147	CLIP-seq
MIRT2623286	hsa-miR-200a	CLIP-seq
MIRT2623287	hsa-miR-3142	CLIP-seq
MIRT1352863	hsa-miR-324-5p	CLIP-seq
MIRT2623288	hsa-miR-338-3p	CLIP-seq
MIRT2623289	hsa-miR-33a	CLIP-seq
MIRT2623290	hsa-miR-33b	CLIP-seq
MIRT2623291	hsa-miR-3607-3p	CLIP-seq
MIRT2623292	hsa-miR-3686	CLIP-seq
MIRT2623293	hsa-miR-3911	CLIP-seq
MIRT2623294	hsa-miR-3921	CLIP-seq
MIRT2623295	hsa-miR-4263	CLIP-seq
MIRT2623296	hsa-miR-4282	CLIP-seq
MIRT2623297	hsa-miR-4464	CLIP-seq
MIRT2623298	hsa-miR-4530	CLIP-seq
MIRT2623299	hsa-miR-4645-5p	CLIP-seq
MIRT2623300	hsa-miR-4652-3p	CLIP-seq
MIRT2623301	hsa-miR-4653-5p	CLIP-seq
MIRT2623302	hsa-miR-4659a-5p	CLIP-seq
MIRT2623303	hsa-miR-4659b-5p	CLIP-seq
MIRT2623304	hsa-miR-4673	CLIP-seq
MIRT2328905	hsa-miR-4684-5p	CLIP-seq
MIRT2623305	hsa-miR-4686	CLIP-seq
MIRT2623306	hsa-miR-4727-5p	CLIP-seq
MIRT2623307	hsa-miR-4748	CLIP-seq
MIRT2623308	hsa-miR-4753-5p	CLIP-seq
MIRT2623309	hsa-miR-4766-5p	CLIP-seq
MIRT2328906	hsa-miR-4768-5p	CLIP-seq
MIRT2623310	hsa-miR-4769-3p	CLIP-seq
MIRT2623311	hsa-miR-488	CLIP-seq
MIRT2623312	hsa-miR-520d-5p	CLIP-seq
MIRT2623313	hsa-miR-524-5p	CLIP-seq
MIRT2623314	hsa-miR-548c-3p	CLIP-seq
MIRT2623315	hsa-miR-586	CLIP-seq
MIRT2623316	hsa-miR-599	CLIP-seq
MIRT2623317	hsa-miR-644	CLIP-seq
MIRT2623318	hsa-miR-942	CLIP-seq
MIRT2623281	hsa-miR-1236	CLIP-seq
MIRT2623282	hsa-miR-1245b-5p	CLIP-seq
MIRT2690887	hsa-miR-1257	CLIP-seq
MIRT2623283	hsa-miR-1322	CLIP-seq
MIRT2623284	hsa-miR-141	CLIP-seq
MIRT2623285	hsa-miR-147	CLIP-seq
MIRT2623286	hsa-miR-200a	CLIP-seq
MIRT2623287	hsa-miR-3142	CLIP-seq
MIRT1352863	hsa-miR-324-5p	CLIP-seq
MIRT2623288	hsa-miR-338-3p	CLIP-seq
MIRT2623291	hsa-miR-3607-3p	CLIP-seq
MIRT2690888	hsa-miR-3649	CLIP-seq
MIRT2623292	hsa-miR-3686	CLIP-seq
MIRT2690889	hsa-miR-377	CLIP-seq
MIRT2623293	hsa-miR-3911	CLIP-seq
MIRT2623295	hsa-miR-4263	CLIP-seq
MIRT2623296	hsa-miR-4282	CLIP-seq
MIRT2690890	hsa-miR-4289	CLIP-seq
MIRT2623297	hsa-miR-4464	CLIP-seq
MIRT2623298	hsa-miR-4530	CLIP-seq
MIRT2623299	hsa-miR-4645-5p	CLIP-seq
MIRT2623300	hsa-miR-4652-3p	CLIP-seq
MIRT2623302	hsa-miR-4659a-5p	CLIP-seq
MIRT2623303	hsa-miR-4659b-5p	CLIP-seq
MIRT2690891	hsa-miR-4668-5p	CLIP-seq
MIRT2623304	hsa-miR-4673	CLIP-seq
MIRT2328905	hsa-miR-4684-5p	CLIP-seq
MIRT2623305	hsa-miR-4686	CLIP-seq
MIRT2690892	hsa-miR-4694-3p	CLIP-seq
MIRT2623306	hsa-miR-4727-5p	CLIP-seq
MIRT2623307	hsa-miR-4748	CLIP-seq
MIRT2623308	hsa-miR-4753-5p	CLIP-seq
MIRT2328906	hsa-miR-4768-5p	CLIP-seq
MIRT2623310	hsa-miR-4769-3p	CLIP-seq
MIRT2690893	hsa-miR-4789-3p	CLIP-seq
MIRT2623311	hsa-miR-488	CLIP-seq
MIRT2623312	hsa-miR-520d-5p	CLIP-seq
MIRT2690894	hsa-miR-522	CLIP-seq
MIRT2623313	hsa-miR-524-5p	CLIP-seq
MIRT2623314	hsa-miR-548c-3p	CLIP-seq
MIRT2623316	hsa-miR-599	CLIP-seq
MIRT2623317	hsa-miR-644	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
USF1	Unknown	15691871

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	10921872, 32814053
GO:0005813	Component	Centrosome	IDA	23816619
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	15505343, 23137377, 24390345, 25371203, 25957687, 28112518
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0007098	Process	Centrosome cycle	IMP	23816619
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	IDA	25371203
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	IEA
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	ISS
GO:0008028	Function	Monocarboxylic acid transmembrane transporter activity	TAS	8124722
GO:0009925	Component	Basal plasma membrane	IDA	26854723
GO:0015129	Function	Lactate transmembrane transporter activity	IEA
GO:0015129	Function	Lactate transmembrane transporter activity	ISS
GO:0015129	Function	Lactate transmembrane transporter activity	TAS	25371203
GO:0015130	Function	Mevalonate transmembrane transporter activity	TAS	1429658
GO:0015141	Function	Succinate transmembrane transporter activity	IDA	32946811
GO:0015293	Function	Symporter activity	IEA
GO:0015295	Function	Solute:proton symporter activity	IEA
GO:0015355	Function	Secondary active monocarboxylate transmembrane transporter activity	IEA
GO:0015650	Function	Lactate:proton symporter activity	IBA
GO:0015650	Function	Lactate:proton symporter activity	IDA	12946269
GO:0015650	Function	Lactate:proton symporter activity	IEA
GO:0015718	Process	Monocarboxylic acid transport	IDA	25371203
GO:0015718	Process	Monocarboxylic acid transport	IEA
GO:0015718	Process	Monocarboxylic acid transport	ISS
GO:0015718	Process	Monocarboxylic acid transport	TAS	8124722
GO:0015728	Process	Mevalonate transport	TAS	1429658
GO:0016020	Component	Membrane	HDA	19946888
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	1429658, 8124722
GO:0016323	Component	Basolateral plasma membrane	IBA
GO:0016323	Component	Basolateral plasma membrane	IEA
GO:0016323	Component	Basolateral plasma membrane	ISS	18619525
GO:0016324	Component	Apical plasma membrane	IDA	15901598, 26854723, 31678436, 31791063
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS	18619525
GO:0016328	Component	Lateral plasma membrane	IDA	26854723
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0030054	Component	Cell junction	IDA
GO:0032094	Process	Response to food	IEA
GO:0035873	Process	Lactate transmembrane transport	IEA
GO:0035879	Process	Plasma membrane lactate transport	IBA
GO:0035879	Process	Plasma membrane lactate transport	IEA
GO:0035879	Process	Plasma membrane lactate transport	ISS
GO:0035879	Process	Plasma membrane lactate transport	TAS	25371203
GO:0042593	Process	Glucose homeostasis	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042867	Process	Pyruvate catabolic process	IEA
GO:0045202	Component	Synapse	IEA
GO:0046943	Function	Carboxylic acid transmembrane transporter activity	IEA
GO:0046943	Function	Carboxylic acid transmembrane transporter activity	ISS
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0051780	Process	Behavioral response to nutrient	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0071422	Process	Succinate transmembrane transport	IDA	32946811
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1901475	Process	Pyruvate transmembrane transport	IEA
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1905039	Process	Carboxylic acid transmembrane transport	IEA
GO:1905039	Process	Carboxylic acid transmembrane transport	ISS

MIM	HGNC	e!Ensembl
600682	10922	ENSG00000155380

P53985

Protein name

Monocarboxylate transporter 1 (MCT 1) (Solute carrier family 16 member 1)

Protein function

Bidirectional proton-coupled monocarboxylate transporter (PubMed:12946269, PubMed:32946811, PubMed:33333023). Catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, acetate and the ketone bod

PDB

6LYY , 6LZ0 , 7CKO , 7CKR , 7DA5 , 7YR5

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07690	MFS_1	22 → 406	Major Facilitator Superfamily	Family
PF07690	MFS_1	331 → 484	Major Facilitator Superfamily	Family

Tissue specificity

TISSUE SPECIFICITY: Widely expressed (PubMed:12115955, PubMed:15505343, PubMed:15901598). Detected in heart and in blood lymphocytes and monocytes (at protein level) (PubMed:15505343). {ECO:0000269|PubMed:12115955, ECO:0000269|PubMed:15505343, ECO:0000269

Sequence

MPPAVGGPVGYTPPDGGWGWAVVIGAFISIGFSYAFPKSITVFFKEIEGIFHATTSEVSW
ISSIMLAVMYGGGPISSILVNKYGSRIVMIVGGCLSGCGLIAASFCNTVQQLYVCIGVIG
GLGLAFNLNPALTMIGKYFYKRRPLANGLAMAGSPVFLCTLAPLNQVFFGIFGWRGSFLI
LGGLLLNCCVAGALMRPIGPKPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQ
EKRSVFQTINQFLDLTLFTHRGFLLYLSGNVIMFFGLFAPLVFLSSYGKSQHYSSEKSAF
LLSILAFVDMVARPSMGLVANTKPIRPRIQYFFAASVVANGVCHMLAPLSTTYVGFCVYA
GFFGFAFGWLSSVLFETLMDLVGPQRFSSAVGLVTIVECCPVLLGPPLLGRLNDMYGDYK
YTYWACGVVLIISGIYLFIGMGINYRLLAKEQKANEQKKESKEEETSIDVAGKPNEVTKA
AESPDQKDTDGGPKEEESPV

Sequence length

500

Interactions

View interactions

	KEGG		Reactome
	Efferocytosis		Basigin interactions Proton-coupled monocarboxylate transport Defective SLC16A1 causes symptomatic deficiency in lactate transport (SDLT) Pyruvate metabolism

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Exercise-induced hyperinsulinism	Pathogenic; Likely pathogenic	rs606231310, rs387906403, rs606231172, rs1570619302, rs1570623881	RCV000986394 RCV000009471 RCV000009472 RCV004761847 RCV001027697	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Ketoacidosis due to monocarboxylate transporter-1 deficiency	Likely pathogenic; Pathogenic	rs606231311, rs606231309, rs1570619302	RCV003114292 RCV003335796 RCV000985073	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Metabolic myopathy due to lactate transporter defect	Likely pathogenic; Pathogenic	rs606231311	RCV001542540	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Monocarboxylate transporter 1 deficiency, autosomal dominant	Pathogenic; Likely pathogenic	rs606231300, rs606231301, rs606231302, rs606231311, rs606231312	RCV000145410 RCV000145412 RCV000145414 RCV000148038 RCV000148039	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Monocarboxylate transporter 1 deficiency, autosomal recessive	Pathogenic	rs606231310	RCV000148037	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SLC16A1-related disorder	Pathogenic	rs557581298, rs2525088360, rs1383418191	RCV003405017 RCV003493342 RCV004579647	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (18)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISM SPECTRUM DISORDER	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF FATTY ACID AND KETONE BODY METABOLISM	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DISORDER OF FATTY ACID OXIDATION AND KETONE BODY METABOLISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERYTHROCYTE LACTATE TRANSPORTER DEFECT	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINEMIC HYPOGLYCEMIA, FAMILIAL, 7	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERINSULINISM	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinism, Dominant	Conflicting classifications of pathogenicity; Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (212)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	26539827, 26563366, 28206968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	28206968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	31040927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26539827		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	19789340, 28385782, 29534146, 30790227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	19427019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Rickets	Rickets	BEFREE	28858396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	38441044	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	26765963, 30355947		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anophthalmia with pulmonary hypoplasia	Anophthalmia	Pubtator	32633891	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	17957103		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	37304267	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	30550949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	28206968	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25263481, 27373212, 30026847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	28927866		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	21081165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	22575025	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16322206, 21177384, 21870331, 24174370, 24858043, 26203664, 26876179, 28191959, 28421181, 29775610, 29809145, 30397860, 31367191, 31496287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19826085, 20454640, 21177384, 22700320, 23082721, 23172368, 25415228, 27266704, 28333070, 31964840, 34471053, 35512572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	28385782, 29050199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	28385782, 9786900	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35293026, 36930112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11953883, 23211466		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28390113, 29351758, 30923124, 31761783, 33256802, 35293026	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	27880818	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25263481, 27373212, 30026847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	19372582, 26876179, 28394354, 30967777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	37934721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	29481555, 35167383, 36930112, 37848987	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	26539827, 36894874	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26045776, 30132561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carnitine-Acylcarnitine Translocase Deficiency	Carnitine-Acylcarnitine Translocase Deficiency	BEFREE	10653336		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	26563366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	26563366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	19427019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	30341000		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12637315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	11953883		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17182800		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	32703414	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25492048, 28846107, 28874966, 31409796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18188595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18188595, 26021766, 27460659, 30850705, 30867812	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35193569	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	25390740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	31729681		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Hyperinsulinemic hypoglycemia	BEFREE	18156285, 21186003, 23345197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	23345197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Hyperinsulinemic hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29481555, 29657088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	31605138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cyst	Cyst	BEFREE	11678351		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	27982679		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28615651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	33276040, 36340268	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	33426802, 33531564	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	26211669, 28101933		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	12637315, 16815567, 19789340, 28385782, 29248132, 29534146, 30790227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36525280	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	30022509, 30952578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	21081165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Generalized	Epilepsy	BEFREE	24483274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	21081165		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26045776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Erythrocyte Lactate Transporter Defect	Erythrocyte Lactate Transporter Defect	ORPHANET_DG	10590411		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Erythrocyte Lactate Transporter Defect	Erythrocyte Lactate Transporter Defect	UNIPROT_DG	10590411		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Erythrocyte Lactate Transporter Defect	Erythrocyte Lactate Transporter Defect	GENOMICS_ENGLAND_DG	12502513		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Erythrocyte Lactate Transporter Defect	Erythrocyte Lactate Transporter Defect	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Erythrocyte Lactate Transporter Defect	Erythrocyte Lactate Transporter Defect	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial medullary thyroid carcinoma	Medullary thyroid carcinoma	BEFREE	2310607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	29092796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	25548511, 29698634	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	22281667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Generalized seizures	Seizure	BEFREE	30952578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	33137197	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	15574223, 23258846, 26902636, 28762551, 29066459, 29928884, 30416849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26902636, 27354342, 28365151, 29066459, 32872409, 35609320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15574223, 23258846, 26902636, 28762551, 29066459, 29928884, 30416849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	27144334, 27437179, 32637597, 34911188	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23574725, 33633176, 39619326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure, Right-Sided	Heart Failure	BEFREE	29362961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	20454640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	29248133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	Pubtator	26615135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29532970		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinemic hypoglycemia	Hyperinsulinemic hypoglycemia	BEFREE	19254908, 31137773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinemic hypoglycemia	Hyperinsulinemic hypoglycemia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinemic hypoglycemia, familial, 7	Hyperinsulinemic hypoglycemia	GENOMICS_ENGLAND_DG	17701893		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinemic hypoglycemia, familial, 7	Hyperinsulinemic hypoglycemia	ORPHANET_DG	17701893		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinemic hypoglycemia, familial, 7	Hyperinsulinemic hypoglycemia	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperinsulinemic hypoglycemia, familial, 7	Hyperinsulinemic hypoglycemia	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	30031694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	17701893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	LHGDN	17701893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemic coma	Hypoglycemic coma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemic seizures	Hypoglycemic seizures	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	25170642, 30934693, 35188217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	32637597	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	23525442, 29362961, 29969608, 30031694, 30703554, 31060005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31326499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18054563		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	31211831	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	23073708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	28421181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	33625995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketoacidosis due to monocarboxylate transporter-1 deficiency	Ketoacidosis	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ketonuria	Ketonuria	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	25390740, 31380330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	35167383	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29137304		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25868689, 28390113, 29351758		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21306479, 30590402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31371390	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27460659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28206968	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	12637315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	17016429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26434591, 28923861, 29534146, 29674138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	12637315	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	12637315		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	30790227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	16815567, 30790227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	30790227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	30009661	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12759536, 16322206, 21177384, 21870331, 24858043, 26876179, 28191959, 28421181, 29775610, 29809145, 30397860, 30885232, 31367191, 31496287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31297034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	19372582, 26876179, 28394354, 30967777		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26045776, 30132561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	27240355, 28260082, 31404019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22850421, 24597899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19628385, 27224918, 28235486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25263481, 27373212, 30026847		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11953883, 12637315, 16322206, 16815567, 19033652, 22281667, 23211466, 24012639, 24166504, 24285728, 24858043, 25894929, 25957999, 26876179, 27127175 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	11953883		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22184616, 24858043, 26876179, 30617815		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mastocytosis	Mastocytosis	BEFREE	28609557		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	723634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	19427019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23043612	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	26615135, 31048755, 34254872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	27105345, 31605138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37506884	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	34254872	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28615651		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	32887638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31727576		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic myopathy due to lactate transporter defect	Metabolic Myopathy	Orphanet			★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28558739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	29248133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MONOCARBOXYLATE TRANSPORTER 1 DEFICIENCY	MONOCARBOXYLATE TRANSPORTER 1 DEFICIENCY	ORPHANET_DG	25390740		★★★★★ ★☆☆☆☆ Found in Text Mining only
MONOCARBOXYLATE TRANSPORTER 1 DEFICIENCY	MONOCARBOXYLATE TRANSPORTER 1 DEFICIENCY	UNIPROT_DG	25390740		★★★★★ ★☆☆☆☆ Found in Text Mining only
MONOCARBOXYLATE TRANSPORTER 1 DEFICIENCY	MONOCARBOXYLATE TRANSPORTER 1 DEFICIENCY	CTD_human_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Motor neuron atrophy	Motor neuron atrophy	BEFREE	31290185		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	21787388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	27232157, 34769160	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple endocrine neoplasia Type 2	Multiple Endocrine Neoplasia	BEFREE	723634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 2a	Multiple Endocrine Neoplasia	BEFREE	723634, 779598		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	24013424, 26384349, 34768284	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	26384349, 29695106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28392448, 28822986		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30304133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29882205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12637315, 16322206, 19033652, 19033663, 19427019, 21930917, 22184616, 22678117, 23211466, 24012639, 24285728, 24597899, 25263481, 25456395, 26434591 View all (31 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17000864, 26434591, 31605138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25225794, 25578492, 25894929		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	18079261	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25614204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomalacia	Osteomalacia	BEFREE	28858396		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24012639		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	34440306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26045776, 30132561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20454640	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	27240355, 28260082, 31404019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	31404019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	27240355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28260082, 32355273	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary Renal Cell Carcinoma	Papillary Renal Carcinoma	BEFREE	28028797		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parathyroid hyperplasia	Parathyroid hyperplasia	BEFREE	723634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23963315, 30754730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33137089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22850421, 24597899		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21787388, 22895074, 24886074, 31564440	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30031694		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31297034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal detachment	Pubtator	36652553	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinopathy of Prematurity	Retinopathy	BEFREE	28990934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	15997097	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Right Ventricular Hypertrophy	Ventricular hypertrophy	BEFREE	23525442, 25320332		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	24885736	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	11943706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30260458		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Limited	Scleroderma	Pubtator	36652553	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	25957999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26539827, 26563366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30720131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29207019, 34769160	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	31391008, 32450050, 33633176, 38422829	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30429503		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29092796		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19628385, 27224918, 28235486		★★★★★ ★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	12637315, 15897892, 16815567, 16982740, 29534146		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	36930112	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	28421181, 30115973, 30397860, 30885232		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35406740	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	21987487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	26125467, 26636903, 32863950	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19597291	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D Deficiency	Vitamin d deficiency	Pubtator	33625995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC16A1 (solute carrier family 16 member 1)