SLC9A5 (solute carrier family 9 member A5)

Gene

• Entrez ID: 6553
• Gene name: Solute carrier family 9 member A5
• Gene symbol: SLC9A5
• Synonyms (NCBI Gene): NHE5
• Chromosome: 16
• Chromosome location: 16q22.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT026697	hsa-miR-192-5p	Microarray	19074876
MIRT1369005	hsa-miR-1207-5p	CLIP-seq
MIRT1369006	hsa-miR-1258	CLIP-seq
MIRT1369007	hsa-miR-125a-5p	CLIP-seq
MIRT1369008	hsa-miR-125b	CLIP-seq
MIRT1369009	hsa-miR-1273f	CLIP-seq
MIRT1369010	hsa-miR-1291	CLIP-seq
MIRT1369011	hsa-miR-143	CLIP-seq
MIRT1369012	hsa-miR-15a	CLIP-seq
MIRT1369013	hsa-miR-15b	CLIP-seq
MIRT1369014	hsa-miR-16	CLIP-seq
MIRT1369015	hsa-miR-1909	CLIP-seq
MIRT1369016	hsa-miR-1912	CLIP-seq
MIRT1369017	hsa-miR-1915	CLIP-seq
MIRT1369018	hsa-miR-195	CLIP-seq
MIRT1369019	hsa-miR-22	CLIP-seq
MIRT1369020	hsa-miR-2278	CLIP-seq
MIRT1369021	hsa-miR-28-5p	CLIP-seq
MIRT1369022	hsa-miR-3139	CLIP-seq
MIRT1369023	hsa-miR-3179	CLIP-seq
MIRT1369024	hsa-miR-3202	CLIP-seq
MIRT1369025	hsa-miR-328	CLIP-seq
MIRT1369026	hsa-miR-3677-5p	CLIP-seq
MIRT1369027	hsa-miR-3684	CLIP-seq
MIRT1369028	hsa-miR-3976	CLIP-seq
MIRT1369029	hsa-miR-424	CLIP-seq
MIRT1369030	hsa-miR-4266	CLIP-seq
MIRT1369031	hsa-miR-4301	CLIP-seq
MIRT1369032	hsa-miR-4319	CLIP-seq
MIRT1369033	hsa-miR-4324	CLIP-seq
MIRT1369034	hsa-miR-4519	CLIP-seq
MIRT1369035	hsa-miR-4668-5p	CLIP-seq
MIRT1369036	hsa-miR-4707-5p	CLIP-seq
MIRT1369037	hsa-miR-4708-5p	CLIP-seq
MIRT1369038	hsa-miR-4722-5p	CLIP-seq
MIRT1369039	hsa-miR-4726-3p	CLIP-seq
MIRT1369040	hsa-miR-4731-5p	CLIP-seq
MIRT1369041	hsa-miR-4736	CLIP-seq
MIRT1369042	hsa-miR-4747-5p	CLIP-seq
MIRT1369043	hsa-miR-4763-3p	CLIP-seq
MIRT1369044	hsa-miR-4767	CLIP-seq
MIRT1369045	hsa-miR-4770	CLIP-seq
MIRT1369046	hsa-miR-4796-3p	CLIP-seq
MIRT1369047	hsa-miR-497	CLIP-seq
MIRT1369048	hsa-miR-646	CLIP-seq
MIRT1369049	hsa-miR-663b	CLIP-seq
MIRT1369050	hsa-miR-708	CLIP-seq
MIRT1369051	hsa-miR-922	CLIP-seq
MIRT2109620	hsa-miR-1224-3p	CLIP-seq
MIRT2109621	hsa-miR-1260	CLIP-seq
MIRT2109622	hsa-miR-1260b	CLIP-seq
MIRT2109623	hsa-miR-1280	CLIP-seq
MIRT2109624	hsa-miR-1913	CLIP-seq
MIRT2109625	hsa-miR-3189-5p	CLIP-seq
MIRT2109626	hsa-miR-324-3p	CLIP-seq
MIRT2109627	hsa-miR-324-5p	CLIP-seq
MIRT2109628	hsa-miR-4758-3p	CLIP-seq
MIRT2109629	hsa-miR-4763-5p	CLIP-seq
MIRT2109630	hsa-miR-532-3p	CLIP-seq
MIRT2332819	hsa-miR-1197	CLIP-seq
MIRT2332820	hsa-miR-1245b-5p	CLIP-seq
MIRT2332821	hsa-miR-3142	CLIP-seq
MIRT2332822	hsa-miR-4436a	CLIP-seq
MIRT2332823	hsa-miR-4645-5p	CLIP-seq
MIRT2332824	hsa-miR-4662a-5p	CLIP-seq
MIRT2332825	hsa-miR-4673	CLIP-seq
MIRT2332826	hsa-miR-4676-5p	CLIP-seq
MIRT2332827	hsa-miR-4690-3p	CLIP-seq
MIRT2332828	hsa-miR-4755-3p	CLIP-seq
MIRT2332829	hsa-miR-575	CLIP-seq
MIRT1369005	hsa-miR-1207-5p	CLIP-seq
MIRT2627157	hsa-miR-1825	CLIP-seq
MIRT2627158	hsa-miR-3130-5p	CLIP-seq
MIRT2627159	hsa-miR-3150a-3p	CLIP-seq
MIRT2627160	hsa-miR-3175	CLIP-seq
MIRT2627161	hsa-miR-4259	CLIP-seq
MIRT2627162	hsa-miR-4260	CLIP-seq
MIRT2627163	hsa-miR-4419a	CLIP-seq
MIRT2627164	hsa-miR-4482	CLIP-seq
MIRT2627165	hsa-miR-4510	CLIP-seq
MIRT2627166	hsa-miR-4642	CLIP-seq
MIRT2627167	hsa-miR-4667-5p	CLIP-seq
MIRT2627168	hsa-miR-4700-5p	CLIP-seq
MIRT2627169	hsa-miR-4720-5p	CLIP-seq
MIRT2627170	hsa-miR-4728-5p	CLIP-seq
MIRT1369040	hsa-miR-4731-5p	CLIP-seq
MIRT1369042	hsa-miR-4747-5p	CLIP-seq
MIRT1369043	hsa-miR-4763-3p	CLIP-seq
MIRT2627171	hsa-miR-4799-3p	CLIP-seq
MIRT2627172	hsa-miR-486-3p	CLIP-seq
MIRT2627173	hsa-miR-512-3p	CLIP-seq
MIRT2627174	hsa-miR-571	CLIP-seq
MIRT2627175	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	19276089, 24006492
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	21296876
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IDA	24006492
GO:0005925	Component	Focal adhesion	IEA
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006812	Process	Monoatomic cation transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0006885	Process	Regulation of pH	IEA
GO:0015297	Function	Antiporter activity	IEA
GO:0015385	Function	Sodium:proton antiporter activity	IBA
GO:0015385	Function	Sodium:proton antiporter activity	IDA	10692428
GO:0015385	Function	Sodium:proton antiporter activity	IEA
GO:0015385	Function	Sodium:proton antiporter activity	TAS	9933641
GO:0015386	Function	Potassium:proton antiporter activity	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	9933641
GO:0032591	Component	Dendritic spine membrane	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IDA	10692428
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0042995	Component	Cell projection	IEA
GO:0044309	Component	Neuron spine	IDA	21551074
GO:0045202	Component	Synapse	IDA	21551074
GO:0045202	Component	Synapse	IEA
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0051453	Process	Regulation of intracellular pH	IBA
GO:0051453	Process	Regulation of intracellular pH	IDA	24936055
GO:0055038	Component	Recycling endosome membrane	IDA	12205089, 21296876
GO:0055038	Component	Recycling endosome membrane	IEA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0097060	Component	Synaptic membrane	IEA
GO:0098719	Process	Sodium ion import across plasma membrane	IBA
GO:1902600	Process	Proton transmembrane transport	IEA
GO:1990763	Function	Arrestin family protein binding	IDA	15699339

Other IDs

• MIM: 600477
• HGNC: 11078
• e!Ensembl: ENSG00000135740

Protein

• UniProt ID: Q14940
• Protein name: Sodium/hydrogen exchanger 5 (Na(+)/H(+) exchanger 5) (NHE-5) (Solute carrier family 9 member 5)
• Protein function: Plasma membrane Na(+)/H(+) antiporter. Mediates the electroneutral exchange of intracellular H(+) ions for extracellular Na(+) in 1:1 stoichiometry, thus regulating intracellular pH homeostasis, in particular in neural tissues (PubMed:10692428,
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00999	Na_H_Exchanger	50 → 455	Sodium/hydrogen exchanger family	Family

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in brain (PubMed:7759094, PubMed:9933641). Expressed in neurons of the central and peripheral nervous system (PubMed:21551074, PubMed:9933641). Expressed also in testis, spleen, and skeletal muscle (PubMed:7759094). {E
• Sequence:

  MLRAALSLLALPLAGAAEEPTQKPESPGEPPPGLELFRWQWHEVEAPYLVALWILVASLA
  KIVFHLSRKVTSLVPESCLLILLGLVLGGIVLAVAKKAEYQLEPGTFFLFLLPPIVLDSG
  YFMPSRLFFDNLGAILTYAVVGTLWNAFTTGAALWGLQQAGLVAPRVQAGLLDFLLFGSL
  ISAVDPVAVLAVFEEVHVNETLFIIVFGESLLNDAVTVVLYKVCNSFVEMGSANVQATDY
  LKGVASLFVVSLGGAAVGLVFAFLLALTTRFTKRVRIIEPLLVFLLAYAAYLTAEMASLS
  AILAVTMCGLGCKKYVEANISHKSRTTVKYTMKTLASCAETVIFMLLGISAVDSSKWAWD
  SGLVLGTLIFILFFRALGVVLQTWVLNQFRLVPLDKIDQVVMSYGGLRGAVAFALVILLD
  RTKVPAKDYFVATTIVVVFFTVIVQGLTIKPLVKWLKVKRSEHHKPTLNQELHEHTFDHI
  LAAVEDVVGHHGYHYWRDRWEQFDKKYLSQLLMRRSAYRIRDQIWDVYYRLNIRDAISFV
  DQGGHVLSSTGLTLPSMPSRNSVAETSVTNLLRESGSGACLDLQVIDTVRSGRDREDAVM
  HHLLCGGLYKPRRRYKASCSRHFISEDAQERQDKEVFQQNMKRRLESFKSTKHNICFTKS
  KPRPRKTGRRKKDGVANAEATNGKHRGLGFQDTAAVILTVESEEEEEESDSSETEKEDDE
  GIIFVARATSEVLQEGKVSGSLEVCPSPRIIPPSPTCAEKELPWKSGQGDLAVYVSSETT
  KIVPVDMQTGWNQSISSLESLASPPCNQAPILTCLPPHPRGTEEPQVPLHLPSDPRSSFA
  FPPSLAKAGRSRSESSADLPQQQELQPLMGHKDHTHLSPGTATSHWCIQFNRGSRL

• Sequence length: 896

Pathways

Reactome:

Sodium/Proton exchangers

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
KIDNEY FAILURE, CHRONIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Chronic kidney disease stage 5	Kidney Disease	BEFREE	10642288		★☆☆☆☆ Found in Text Mining only
Congenital secretory diarrhea, sodium type (disorder)	Congenital secretory diarrhea	BEFREE	11113072		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	29864786		★☆☆☆☆ Found in Text Mining only
Episodic Kinesigenic Dyskinesia 1	Episodic Kinesigenic Dyskinesia	BEFREE	12203045		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	31595389		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	24278418		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	10642288		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	31595389		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	24278418		★☆☆☆☆ Found in Text Mining only
Obstructive azoospermia	Obstructive azoospermia	BEFREE	30956978		★☆☆☆☆ Found in Text Mining only