Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	655
Gene name	Bone morphogenetic protein 7
Gene symbol	BMP7
Synonyms (NCBI Gene)	OP-1
Chromosome	20
Chromosome location	20q13.31
Summary	This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1555815731	G>-	Pathogenic	Coding sequence variant, frameshift variant

465

Show/Hide all (465)

miRTarBase ID	miRNA	Experiments	Reference
MIRT002000	hsa-miR-22-3p	Luciferase reporter assay	19011694
MIRT002000	hsa-miR-22-3p	qRT-PCRLuciferase reporter assayWestern blot	19011694
MIRT005882	hsa-miR-342-3p	Luciferase reporter assayNorthern blotqRT-PCR	21172025
MIRT007204	hsa-miR-34a-5p	Western blot	23226240
MIRT023527	hsa-miR-1-3p	Microarray	18668037
MIRT052250	hsa-let-7b-5p	CLASH	23622248
MIRT437421	hsa-miR-542-3p	Luciferase reporter assayqRT-PCRWestern blot	24503542
MIRT002000	hsa-miR-22-3p	Luciferase reporter assay	24163368
MIRT002000	hsa-miR-22-3p	Luciferase reporter assay	24163368
MIRT660245	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT660244	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT660243	hsa-miR-326	HITS-CLIP	23824327
MIRT660242	hsa-miR-330-5p	HITS-CLIP	23824327
MIRT660241	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT660240	hsa-miR-4667-5p	HITS-CLIP	23824327
MIRT660239	hsa-miR-4700-5p	HITS-CLIP	23824327
MIRT660238	hsa-miR-8089	HITS-CLIP	23824327
MIRT660237	hsa-miR-637	HITS-CLIP	23824327
MIRT660236	hsa-miR-7155-5p	HITS-CLIP	23824327
MIRT660235	hsa-miR-4284	HITS-CLIP	23824327
MIRT660234	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT660233	hsa-miR-193b-5p	HITS-CLIP	23824327
MIRT660232	hsa-miR-3170	HITS-CLIP	23824327
MIRT660231	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT732128	hsa-miR-137	Luciferase reporter assayWestern blot	26617798
MIRT732128	hsa-miR-137	Luciferase reporter assayWestern blot	26617798
MIRT437421	hsa-miR-542-3p	Luciferase reporter assayqRT-PCRWestern blot	26610487
MIRT437421	hsa-miR-542-3p	Luciferase reporter assayqRT-PCRWestern blot	26610487
MIRT437421	hsa-miR-542-3p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCR	31829291
MIRT660245	hsa-miR-6890-3p	HITS-CLIP	23824327
MIRT660244	hsa-miR-1304-3p	HITS-CLIP	23824327
MIRT660243	hsa-miR-326	HITS-CLIP	23824327
MIRT660242	hsa-miR-330-5p	HITS-CLIP	23824327
MIRT660241	hsa-miR-4772-3p	HITS-CLIP	23824327
MIRT660240	hsa-miR-4667-5p	HITS-CLIP	23824327
MIRT660239	hsa-miR-4700-5p	HITS-CLIP	23824327
MIRT660238	hsa-miR-8089	HITS-CLIP	23824327
MIRT660237	hsa-miR-637	HITS-CLIP	23824327
MIRT660236	hsa-miR-7155-5p	HITS-CLIP	23824327
MIRT660235	hsa-miR-4284	HITS-CLIP	23824327
MIRT660234	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT660233	hsa-miR-193b-5p	HITS-CLIP	23824327
MIRT660232	hsa-miR-3170	HITS-CLIP	23824327
MIRT660231	hsa-miR-6855-5p	HITS-CLIP	23824327
MIRT755762	hsa-miR?370?3p	Luciferase reporter assayWestern blottingqRT-PCRIn situ hybridization	36765143
MIRT822488	hsa-miR-1	CLIP-seq
MIRT822489	hsa-miR-105	CLIP-seq
MIRT822490	hsa-miR-1178	CLIP-seq
MIRT822491	hsa-miR-1227	CLIP-seq
MIRT822492	hsa-miR-1228	CLIP-seq
MIRT822493	hsa-miR-1238	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT822495	hsa-miR-1321	CLIP-seq
MIRT822496	hsa-miR-146a	CLIP-seq
MIRT822497	hsa-miR-146b-5p	CLIP-seq
MIRT822498	hsa-miR-194	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT822500	hsa-miR-1976	CLIP-seq
MIRT822501	hsa-miR-206	CLIP-seq
MIRT822502	hsa-miR-2110	CLIP-seq
MIRT822503	hsa-miR-24	CLIP-seq
MIRT822504	hsa-miR-2682	CLIP-seq
MIRT822505	hsa-miR-3150a-3p	CLIP-seq
MIRT822506	hsa-miR-3158-5p	CLIP-seq
MIRT822507	hsa-miR-3162-5p	CLIP-seq
MIRT822508	hsa-miR-3166	CLIP-seq
MIRT822509	hsa-miR-3180	CLIP-seq
MIRT822510	hsa-miR-3180-3p	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT822512	hsa-miR-3196	CLIP-seq
MIRT822513	hsa-miR-3661	CLIP-seq
MIRT822514	hsa-miR-3663-5p	CLIP-seq
MIRT822515	hsa-miR-3672	CLIP-seq
MIRT822516	hsa-miR-3673	CLIP-seq
MIRT822517	hsa-miR-370	CLIP-seq
MIRT822518	hsa-miR-3714	CLIP-seq
MIRT822519	hsa-miR-3907	CLIP-seq
MIRT822520	hsa-miR-3929	CLIP-seq
MIRT822521	hsa-miR-3944-5p	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822523	hsa-miR-4252	CLIP-seq
MIRT822524	hsa-miR-4259	CLIP-seq
MIRT822525	hsa-miR-4268	CLIP-seq
MIRT822526	hsa-miR-4271	CLIP-seq
MIRT822527	hsa-miR-4279	CLIP-seq
MIRT822528	hsa-miR-4286	CLIP-seq
MIRT822529	hsa-miR-4329	CLIP-seq
MIRT822530	hsa-miR-4418	CLIP-seq
MIRT822531	hsa-miR-4419b	CLIP-seq
MIRT822532	hsa-miR-4434	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT822534	hsa-miR-4448	CLIP-seq
MIRT822535	hsa-miR-4450	CLIP-seq
MIRT822536	hsa-miR-4478	CLIP-seq
MIRT822537	hsa-miR-449c	CLIP-seq
MIRT822538	hsa-miR-4516	CLIP-seq
MIRT822539	hsa-miR-4531	CLIP-seq
MIRT822540	hsa-miR-4633-5p	CLIP-seq
MIRT822541	hsa-miR-4649-5p	CLIP-seq
MIRT822542	hsa-miR-4691-5p	CLIP-seq
MIRT822543	hsa-miR-4699-3p	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT822547	hsa-miR-4719	CLIP-seq
MIRT822548	hsa-miR-4722-3p	CLIP-seq
MIRT822549	hsa-miR-4725-3p	CLIP-seq
MIRT822550	hsa-miR-4728-5p	CLIP-seq
MIRT822551	hsa-miR-4739	CLIP-seq
MIRT822552	hsa-miR-4743	CLIP-seq
MIRT822553	hsa-miR-4747-5p	CLIP-seq
MIRT822554	hsa-miR-4753-3p	CLIP-seq
MIRT822555	hsa-miR-4755-3p	CLIP-seq
MIRT822556	hsa-miR-4756-5p	CLIP-seq
MIRT822557	hsa-miR-4760-3p	CLIP-seq
MIRT822558	hsa-miR-4771	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822560	hsa-miR-4789-5p	CLIP-seq
MIRT822561	hsa-miR-4796-5p	CLIP-seq
MIRT822562	hsa-miR-485-5p	CLIP-seq
MIRT822563	hsa-miR-493	CLIP-seq
MIRT822564	hsa-miR-498	CLIP-seq
MIRT822565	hsa-miR-509-3-5p	CLIP-seq
MIRT822566	hsa-miR-5095	CLIP-seq
MIRT822567	hsa-miR-509-5p	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT822569	hsa-miR-520a-5p	CLIP-seq
MIRT822570	hsa-miR-525-5p	CLIP-seq
MIRT822571	hsa-miR-548an	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT822573	hsa-miR-552	CLIP-seq
MIRT822574	hsa-miR-561	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT822576	hsa-miR-613	CLIP-seq
MIRT822577	hsa-miR-617	CLIP-seq
MIRT822578	hsa-miR-631	CLIP-seq
MIRT822579	hsa-miR-645	CLIP-seq
MIRT822580	hsa-miR-764	CLIP-seq
MIRT822581	hsa-miR-767-3p	CLIP-seq
MIRT822491	hsa-miR-1227	CLIP-seq
MIRT822492	hsa-miR-1228	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT1943081	hsa-miR-1298	CLIP-seq
MIRT822495	hsa-miR-1321	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT1943082	hsa-miR-1973	CLIP-seq
MIRT822502	hsa-miR-2110	CLIP-seq
MIRT822504	hsa-miR-2682	CLIP-seq
MIRT1943083	hsa-miR-3065-5p	CLIP-seq
MIRT822505	hsa-miR-3150a-3p	CLIP-seq
MIRT822507	hsa-miR-3162-5p	CLIP-seq
MIRT1943084	hsa-miR-3182	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT1943085	hsa-miR-338-3p	CLIP-seq
MIRT1943086	hsa-miR-3607-3p	CLIP-seq
MIRT1943087	hsa-miR-3620	CLIP-seq
MIRT822514	hsa-miR-3663-5p	CLIP-seq
MIRT822515	hsa-miR-3672	CLIP-seq
MIRT1943088	hsa-miR-3678-3p	CLIP-seq
MIRT1943089	hsa-miR-3686	CLIP-seq
MIRT822518	hsa-miR-3714	CLIP-seq
MIRT822519	hsa-miR-3907	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822526	hsa-miR-4271	CLIP-seq
MIRT1943090	hsa-miR-4290	CLIP-seq
MIRT822529	hsa-miR-4329	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT1943091	hsa-miR-4436b-5p	CLIP-seq
MIRT822535	hsa-miR-4450	CLIP-seq
MIRT822537	hsa-miR-449c	CLIP-seq
MIRT1943092	hsa-miR-4504	CLIP-seq
MIRT1943093	hsa-miR-450b-5p	CLIP-seq
MIRT1943094	hsa-miR-4530	CLIP-seq
MIRT1943095	hsa-miR-4652-3p	CLIP-seq
MIRT1943096	hsa-miR-4700-3p	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT822547	hsa-miR-4719	CLIP-seq
MIRT822549	hsa-miR-4725-3p	CLIP-seq
MIRT1943097	hsa-miR-4727-5p	CLIP-seq
MIRT822550	hsa-miR-4728-5p	CLIP-seq
MIRT1943098	hsa-miR-4729	CLIP-seq
MIRT822551	hsa-miR-4739	CLIP-seq
MIRT822553	hsa-miR-4747-5p	CLIP-seq
MIRT822555	hsa-miR-4755-3p	CLIP-seq
MIRT822556	hsa-miR-4756-5p	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822563	hsa-miR-493	CLIP-seq
MIRT822566	hsa-miR-5095	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT1943099	hsa-miR-514	CLIP-seq
MIRT1943100	hsa-miR-514b-3p	CLIP-seq
MIRT1943101	hsa-miR-517b	CLIP-seq
MIRT822571	hsa-miR-548an	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT822573	hsa-miR-552	CLIP-seq
MIRT1943102	hsa-miR-556-3p	CLIP-seq
MIRT822574	hsa-miR-561	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT822577	hsa-miR-617	CLIP-seq
MIRT1943103	hsa-miR-642b	CLIP-seq
MIRT1943104	hsa-miR-651	CLIP-seq
MIRT1943105	hsa-miR-664	CLIP-seq
MIRT1943106	hsa-miR-758	CLIP-seq
MIRT822580	hsa-miR-764	CLIP-seq
MIRT1943107	hsa-miR-873	CLIP-seq
MIRT822488	hsa-miR-1	CLIP-seq
MIRT822489	hsa-miR-105	CLIP-seq
MIRT2181843	hsa-miR-106a	CLIP-seq
MIRT2181844	hsa-miR-106b	CLIP-seq
MIRT2181845	hsa-miR-1202	CLIP-seq
MIRT2181846	hsa-miR-1224-3p	CLIP-seq
MIRT822491	hsa-miR-1227	CLIP-seq
MIRT822492	hsa-miR-1228	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT2181847	hsa-miR-1288	CLIP-seq
MIRT2181848	hsa-miR-1290	CLIP-seq
MIRT2181849	hsa-miR-1293	CLIP-seq
MIRT822495	hsa-miR-1321	CLIP-seq
MIRT2181850	hsa-miR-1322	CLIP-seq
MIRT2181851	hsa-miR-1343	CLIP-seq
MIRT2181852	hsa-miR-138	CLIP-seq
MIRT2181853	hsa-miR-150	CLIP-seq
MIRT2181854	hsa-miR-17	CLIP-seq
MIRT2181855	hsa-miR-1911	CLIP-seq
MIRT822498	hsa-miR-194	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT822500	hsa-miR-1976	CLIP-seq
MIRT2181856	hsa-miR-200b	CLIP-seq
MIRT2181857	hsa-miR-200c	CLIP-seq
MIRT822501	hsa-miR-206	CLIP-seq
MIRT2181858	hsa-miR-20a	CLIP-seq
MIRT2181859	hsa-miR-20b	CLIP-seq
MIRT822502	hsa-miR-2110	CLIP-seq
MIRT2181860	hsa-miR-216a	CLIP-seq
MIRT2181861	hsa-miR-216b	CLIP-seq
MIRT822503	hsa-miR-24	CLIP-seq
MIRT2181862	hsa-miR-25	CLIP-seq
MIRT822504	hsa-miR-2682	CLIP-seq
MIRT2181863	hsa-miR-302a	CLIP-seq
MIRT2181864	hsa-miR-302b	CLIP-seq
MIRT2181865	hsa-miR-302c	CLIP-seq
MIRT2181866	hsa-miR-302d	CLIP-seq
MIRT2181867	hsa-miR-302e	CLIP-seq
MIRT2181868	hsa-miR-3064-3p	CLIP-seq
MIRT2181869	hsa-miR-3127-3p	CLIP-seq
MIRT2181870	hsa-miR-3130-3p	CLIP-seq
MIRT822505	hsa-miR-3150a-3p	CLIP-seq
MIRT822507	hsa-miR-3162-5p	CLIP-seq
MIRT2181871	hsa-miR-3167	CLIP-seq
MIRT2181872	hsa-miR-3169	CLIP-seq
MIRT822509	hsa-miR-3180	CLIP-seq
MIRT822510	hsa-miR-3180-3p	CLIP-seq
MIRT1943084	hsa-miR-3182	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT822512	hsa-miR-3196	CLIP-seq
MIRT2181873	hsa-miR-32	CLIP-seq
MIRT2181874	hsa-miR-329	CLIP-seq
MIRT1943085	hsa-miR-338-3p	CLIP-seq
MIRT2181875	hsa-miR-346	CLIP-seq
MIRT2181876	hsa-miR-3621	CLIP-seq
MIRT2181877	hsa-miR-362-3p	CLIP-seq
MIRT2181878	hsa-miR-363	CLIP-seq
MIRT2181879	hsa-miR-3646	CLIP-seq
MIRT2181880	hsa-miR-3656	CLIP-seq
MIRT822514	hsa-miR-3663-5p	CLIP-seq
MIRT2181881	hsa-miR-3667-3p	CLIP-seq
MIRT2181882	hsa-miR-367	CLIP-seq
MIRT822515	hsa-miR-3672	CLIP-seq
MIRT822516	hsa-miR-3673	CLIP-seq
MIRT1943088	hsa-miR-3678-3p	CLIP-seq
MIRT2181883	hsa-miR-3685	CLIP-seq
MIRT822518	hsa-miR-3714	CLIP-seq
MIRT2181884	hsa-miR-372	CLIP-seq
MIRT2181885	hsa-miR-373	CLIP-seq
MIRT2181886	hsa-miR-377	CLIP-seq
MIRT2181887	hsa-miR-384	CLIP-seq
MIRT822519	hsa-miR-3907	CLIP-seq
MIRT2181888	hsa-miR-3918	CLIP-seq
MIRT2181889	hsa-miR-3926	CLIP-seq
MIRT2181890	hsa-miR-3972	CLIP-seq
MIRT2181891	hsa-miR-3974	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822523	hsa-miR-4252	CLIP-seq
MIRT822524	hsa-miR-4259	CLIP-seq
MIRT822526	hsa-miR-4271	CLIP-seq
MIRT822527	hsa-miR-4279	CLIP-seq
MIRT2181892	hsa-miR-4288	CLIP-seq
MIRT2181893	hsa-miR-429	CLIP-seq
MIRT2181894	hsa-miR-4300	CLIP-seq
MIRT2181895	hsa-miR-4313	CLIP-seq
MIRT2181896	hsa-miR-432	CLIP-seq
MIRT822530	hsa-miR-4418	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT822535	hsa-miR-4450	CLIP-seq
MIRT2181897	hsa-miR-4454	CLIP-seq
MIRT2181898	hsa-miR-4483	CLIP-seq
MIRT822537	hsa-miR-449c	CLIP-seq
MIRT2181899	hsa-miR-4505	CLIP-seq
MIRT1943093	hsa-miR-450b-5p	CLIP-seq
MIRT2181900	hsa-miR-4521	CLIP-seq
MIRT2181901	hsa-miR-4527	CLIP-seq
MIRT1943094	hsa-miR-4530	CLIP-seq
MIRT1943095	hsa-miR-4652-3p	CLIP-seq
MIRT2181902	hsa-miR-4677-3p	CLIP-seq
MIRT2181903	hsa-miR-4685-5p	CLIP-seq
MIRT822542	hsa-miR-4691-5p	CLIP-seq
MIRT822543	hsa-miR-4699-3p	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT2181904	hsa-miR-4708-3p	CLIP-seq
MIRT2181905	hsa-miR-4709-3p	CLIP-seq
MIRT2181906	hsa-miR-4711-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT822547	hsa-miR-4719	CLIP-seq
MIRT822548	hsa-miR-4722-3p	CLIP-seq
MIRT822549	hsa-miR-4725-3p	CLIP-seq
MIRT1943097	hsa-miR-4727-5p	CLIP-seq
MIRT2181907	hsa-miR-4728-3p	CLIP-seq
MIRT822550	hsa-miR-4728-5p	CLIP-seq
MIRT2181908	hsa-miR-4731-5p	CLIP-seq
MIRT2181909	hsa-miR-4733-5p	CLIP-seq
MIRT2181910	hsa-miR-4734	CLIP-seq
MIRT822551	hsa-miR-4739	CLIP-seq
MIRT822553	hsa-miR-4747-5p	CLIP-seq
MIRT822554	hsa-miR-4753-3p	CLIP-seq
MIRT822555	hsa-miR-4755-3p	CLIP-seq
MIRT822556	hsa-miR-4756-5p	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822560	hsa-miR-4789-5p	CLIP-seq
MIRT2181911	hsa-miR-4793-5p	CLIP-seq
MIRT822562	hsa-miR-485-5p	CLIP-seq
MIRT822563	hsa-miR-493	CLIP-seq
MIRT822564	hsa-miR-498	CLIP-seq
MIRT822565	hsa-miR-509-3-5p	CLIP-seq
MIRT822566	hsa-miR-5095	CLIP-seq
MIRT822567	hsa-miR-509-5p	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT2181912	hsa-miR-512-3p	CLIP-seq
MIRT2181913	hsa-miR-519d	CLIP-seq
MIRT2181914	hsa-miR-520a-3p	CLIP-seq
MIRT822569	hsa-miR-520a-5p	CLIP-seq
MIRT2181915	hsa-miR-520b	CLIP-seq
MIRT2181916	hsa-miR-520c-3p	CLIP-seq
MIRT2181917	hsa-miR-520d-3p	CLIP-seq
MIRT2181918	hsa-miR-520e	CLIP-seq
MIRT2181919	hsa-miR-520g	CLIP-seq
MIRT2181920	hsa-miR-520h	CLIP-seq
MIRT822570	hsa-miR-525-5p	CLIP-seq
MIRT2181921	hsa-miR-532-3p	CLIP-seq
MIRT2181922	hsa-miR-548a-3p	CLIP-seq
MIRT2181923	hsa-miR-548ae	CLIP-seq
MIRT2181924	hsa-miR-548aj	CLIP-seq
MIRT2181925	hsa-miR-548am	CLIP-seq
MIRT822571	hsa-miR-548an	CLIP-seq
MIRT2181926	hsa-miR-548e	CLIP-seq
MIRT2181927	hsa-miR-548f	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT2181928	hsa-miR-548x	CLIP-seq
MIRT822573	hsa-miR-552	CLIP-seq
MIRT822574	hsa-miR-561	CLIP-seq
MIRT2181929	hsa-miR-579	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT822576	hsa-miR-613	CLIP-seq
MIRT822577	hsa-miR-617	CLIP-seq
MIRT2181930	hsa-miR-632	CLIP-seq
MIRT1943103	hsa-miR-642b	CLIP-seq
MIRT2181931	hsa-miR-654-3p	CLIP-seq
MIRT2181932	hsa-miR-662	CLIP-seq
MIRT822580	hsa-miR-764	CLIP-seq
MIRT822581	hsa-miR-767-3p	CLIP-seq
MIRT2181933	hsa-miR-876-5p	CLIP-seq
MIRT2181934	hsa-miR-920	CLIP-seq
MIRT2181935	hsa-miR-92a	CLIP-seq
MIRT2181936	hsa-miR-92b	CLIP-seq
MIRT2181937	hsa-miR-93	CLIP-seq
MIRT2181938	hsa-miR-938	CLIP-seq
MIRT2181849	hsa-miR-1293	CLIP-seq
MIRT2181881	hsa-miR-3667-3p	CLIP-seq
MIRT2181898	hsa-miR-4483	CLIP-seq
MIRT2181899	hsa-miR-4505	CLIP-seq
MIRT822542	hsa-miR-4691-5p	CLIP-seq
MIRT822564	hsa-miR-498	CLIP-seq
MIRT2181921	hsa-miR-532-3p	CLIP-seq
MIRT2181932	hsa-miR-662	CLIP-seq
MIRT822491	hsa-miR-1227	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT2444829	hsa-miR-3149	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT2444830	hsa-miR-4735-5p	CLIP-seq
MIRT822555	hsa-miR-4755-3p	CLIP-seq
MIRT2444831	hsa-miR-4775	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT2444832	hsa-miR-590-3p	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT2444829	hsa-miR-3149	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT2444830	hsa-miR-4735-5p	CLIP-seq
MIRT2444831	hsa-miR-4775	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT2444832	hsa-miR-590-3p	CLIP-seq
MIRT822491	hsa-miR-1227	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT2444829	hsa-miR-3149	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT822514	hsa-miR-3663-5p	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT2444830	hsa-miR-4735-5p	CLIP-seq
MIRT822555	hsa-miR-4755-3p	CLIP-seq
MIRT2444831	hsa-miR-4775	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822566	hsa-miR-5095	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT822573	hsa-miR-552	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT2444832	hsa-miR-590-3p	CLIP-seq
MIRT822580	hsa-miR-764	CLIP-seq
MIRT822491	hsa-miR-1227	CLIP-seq
MIRT822494	hsa-miR-1273f	CLIP-seq
MIRT822499	hsa-miR-197	CLIP-seq
MIRT2444829	hsa-miR-3149	CLIP-seq
MIRT822511	hsa-miR-3187-3p	CLIP-seq
MIRT822514	hsa-miR-3663-5p	CLIP-seq
MIRT822522	hsa-miR-411	CLIP-seq
MIRT822533	hsa-miR-4435	CLIP-seq
MIRT822544	hsa-miR-4701-5p	CLIP-seq
MIRT822545	hsa-miR-4715-3p	CLIP-seq
MIRT822546	hsa-miR-4716-5p	CLIP-seq
MIRT2444830	hsa-miR-4735-5p	CLIP-seq
MIRT822555	hsa-miR-4755-3p	CLIP-seq
MIRT2444831	hsa-miR-4775	CLIP-seq
MIRT822559	hsa-miR-4781-3p	CLIP-seq
MIRT822564	hsa-miR-498	CLIP-seq
MIRT822566	hsa-miR-5095	CLIP-seq
MIRT822568	hsa-miR-5096	CLIP-seq
MIRT822572	hsa-miR-548s	CLIP-seq
MIRT822573	hsa-miR-552	CLIP-seq
MIRT822575	hsa-miR-588	CLIP-seq
MIRT2444832	hsa-miR-590-3p	CLIP-seq
MIRT822580	hsa-miR-764	CLIP-seq

Show/Hide all (4)

Transcription factor	Regulation	Reference
HDAC2	Repression	17452977
LDB1	Unknown	17452977
LMO4	Activation	17452977
LMO4	Repression	17452977

136

Show/Hide all (136)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	IEA
GO:0001501	Process	Skeletal system development	TAS	2357959
GO:0001503	Process	Ossification	IEA
GO:0001649	Process	Osteoblast differentiation	IDA	18436533, 34948289
GO:0001649	Process	Osteoblast differentiation	IDA	18436533
GO:0001654	Process	Eye development	IEA
GO:0001656	Process	Metanephros development	IEA
GO:0001656	Process	Metanephros development	IEP	18437684
GO:0001657	Process	Ureteric bud development	IEA
GO:0001657	Process	Ureteric bud development	ISS
GO:0001707	Process	Mesoderm formation	IEA
GO:0001822	Process	Kidney development	IEA
GO:0001823	Process	Mesonephros development	IEA
GO:0001823	Process	Mesonephros development	IEP	18437684
GO:0001837	Process	Epithelial to mesenchymal transition	TAS	14679171
GO:0003272	Process	Endocardial cushion formation	IEA
GO:0003272	Process	Endocardial cushion formation	ISS
GO:0003344	Process	Pericardium morphogenesis	IEA
GO:0003344	Process	Pericardium morphogenesis	ISS
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	9872992, 18339631, 30097509, 31515488, 32296183, 33308444
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	17977014
GO:0005615	Component	Extracellular space	IEA
GO:0007389	Process	Pattern specification process	IEA
GO:0007411	Process	Axon guidance	IEA
GO:0007435	Process	Salivary gland morphogenesis	IEA
GO:0007507	Process	Heart development	IBA
GO:0008083	Function	Growth factor activity	IDA	31208997
GO:0008083	Function	Growth factor activity	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0009880	Process	Embryonic pattern specification	IEA
GO:0009887	Process	Animal organ morphogenesis	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	28124060
GO:0010664	Process	Negative regulation of striated muscle cell apoptotic process	ISS
GO:0010718	Process	Positive regulation of epithelial to mesenchymal transition	IEA
GO:0016358	Process	Dendrite development	TAS	11580864
GO:0021502	Process	Neural fold elevation formation	IEA
GO:0021502	Process	Neural fold elevation formation	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0030326	Process	Embryonic limb morphogenesis	IEA
GO:0030501	Process	Positive regulation of bone mineralization	IDA	18436533
GO:0030509	Process	BMP signaling pathway	IBA
GO:0030509	Process	BMP signaling pathway	IDA	16049014, 17244894, 18436533, 20427544
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030509	Process	BMP signaling pathway	IMP	18326817
GO:0030509	Process	BMP signaling pathway	ISS	8653785
GO:0030509	Process	BMP signaling pathway	TAS	11580864
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030858	Process	Positive regulation of epithelial cell differentiation	IEA
GO:0030902	Process	Hindbrain development	IEA
GO:0030902	Process	Hindbrain development	ISS
GO:0031982	Component	Vesicle	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0033280	Process	Response to vitamin D	IEA
GO:0034116	Process	Positive regulation of heterotypic cell-cell adhesion	IDA	15100360
GO:0035239	Process	Tube morphogenesis	IEA
GO:0036305	Process	Ameloblast differentiation	IEA
GO:0042475	Process	Odontogenesis of dentin-containing tooth	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	31208997
GO:0045597	Process	Positive regulation of cell differentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IDA	16325379
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045666	Process	Positive regulation of neuron differentiation	IEA
GO:0045669	Process	Positive regulation of osteoblast differentiation	IDA	18436533
GO:0045746	Process	Negative regulation of Notch signaling pathway	IEA
GO:0045786	Process	Negative regulation of cell cycle	IDA	11502704
GO:0045839	Process	Negative regulation of mitotic nuclear division	IDA	17244894
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	15100360
GO:0045893	Process	Positive regulation of DNA-templated transcription	IDA	14517293, 15100360, 16049014
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	27923061
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048018	Function	Receptor ligand activity	IEA
GO:0048468	Process	Cell development	IEA
GO:0048593	Process	Camera-type eye morphogenesis	IEA
GO:0048596	Process	Embryonic camera-type eye morphogenesis	IEA
GO:0048646	Process	Anatomical structure formation involved in morphogenesis	IEA
GO:0048738	Process	Cardiac muscle tissue development	IEA
GO:0048738	Process	Cardiac muscle tissue development	ISS
GO:0048754	Process	Branching morphogenesis of an epithelial tube	IEA
GO:0048762	Process	Mesenchymal cell differentiation	IDA	9693150
GO:0048812	Process	Neuron projection morphogenesis	IDA	16325379
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0048812	Process	Neuron projection morphogenesis	IEA
GO:0050768	Process	Negative regulation of neurogenesis	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0051240	Process	Positive regulation of multicellular organismal process	IEA
GO:0060037	Process	Pharyngeal system development	IEA
GO:0060037	Process	Pharyngeal system development	ISS
GO:0060272	Process	Embryonic skeletal joint morphogenesis	IEA
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IDA	9311995, 16049014, 17244894, 19736306, 20427544
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IEA
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	TAS	11580864
GO:0060411	Process	Cardiac septum morphogenesis	IEA
GO:0060411	Process	Cardiac septum morphogenesis	ISS
GO:0060445	Process	Branching involved in salivary gland morphogenesis	IEA
GO:0060485	Process	Mesenchyme development	IEA
GO:0060485	Process	Mesenchyme development	ISS
GO:0060686	Process	Negative regulation of prostatic bud formation	IEA
GO:0060687	Process	Regulation of branching involved in prostate gland morphogenesis	IEA
GO:0060710	Process	Chorio-allantoic fusion	IEA
GO:0060710	Process	Chorio-allantoic fusion	ISS
GO:0061384	Process	Heart trabecula morphogenesis	IEA
GO:0061384	Process	Heart trabecula morphogenesis	ISS
GO:0070487	Process	Monocyte aggregation	IDA	15100360
GO:0070700	Function	BMP receptor binding	IEA
GO:0070700	Function	BMP receptor binding	IPI	18184661
GO:0071456	Process	Cellular response to hypoxia	ISS
GO:0071773	Process	Cellular response to BMP stimulus	IMP	18326817
GO:0072040	Process	Negative regulation of mesenchymal cell apoptotic process involved in nephron morphogenesis	IEA
GO:0072125	Process	Negative regulation of glomerular mesangial cell proliferation	IDA	17244894
GO:0072133	Process	Metanephric mesenchyme morphogenesis	IEA
GO:0072134	Process	Nephrogenic mesenchyme morphogenesis	IEA
GO:0072136	Process	Metanephric mesenchymal cell proliferation involved in metanephros development	IEA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	IMP	27923061
GO:0098609	Process	Cell-cell adhesion	IEA
GO:1900006	Process	Positive regulation of dendrite development	IDA	11580864
GO:1900106	Process	Positive regulation of hyaluranon cable assembly	IDA	15100360
GO:1901145	Process	Mesenchymal cell apoptotic process involved in nephron morphogenesis	IEA
GO:1901223	Process	Negative regulation of non-canonical NF-kappaB signal transduction	ISS
GO:1905069	Process	Allantois development	IEA
GO:1905069	Process	Allantois development	ISS
GO:1905312	Process	Positive regulation of cardiac neural crest cell migration involved in outflow tract morphogenesis	IEA
GO:2000026	Process	Regulation of multicellular organismal development	IEA
GO:2000121	Process	Regulation of removal of superoxide radicals	ISS

MIM	HGNC	e!Ensembl
112267	1074	ENSG00000101144

P18075

Protein name

Bone morphogenetic protein 7 (BMP-7) (Osteogenic protein 1) (OP-1) (Eptotermin alfa)

Protein function

Growth factor of the TGF-beta superfamily that plays important role in various biological processes, including embryogenesis, hematopoiesis, neurogenesis and skeletal morphogenesis (PubMed:31208997). Initiates the canonical BMP signaling cascade

PDB

1BMP , 1LX5 , 1LXI , 1M4U

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00688	TGFb_propeptide	34 → 280	TGF-beta propeptide	Family
PF00019	TGF_beta	329 → 430	Transforming growth factor beta like domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the kidney and bladder. Lower levels seen in the brain.

Sequence

MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLAS
LQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDY
IRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPR
HNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRS
QNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCE
GECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY
RNMVVRACGCH

Sequence length

431

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction TGF-beta signaling pathway Axon guidance Hippo signaling pathway		Molecules associated with elastic fibres

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Congenital heart defects, multiple types, 4	Pathogenic	rs1476787716	RCV002279853	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ventricular septal defect 1	Pathogenic	rs2146036001	RCV002279852	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (27)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANDROGENETIC ALOPECIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial septal defect 8	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BMP7-related disorder	Likely benign; Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BONE RESORPTION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CAKUT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital anomaly of kidney and urinary tract	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital total pulmonary venous return anomaly	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOSPADIAS	—	Disgenet, GenCC Disgenet, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nephrotic syndrome, type 12	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Tetralogy of Fallot	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOXIC NODULAR GOITER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (214)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	15994952		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	24299561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	26337467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	17975199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34556089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	28303752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic Valve Sclerosis	BEFREE	27068510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	26824441, 30107156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	33250156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	26215036	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthropathy	Arthropathy	LHGDN	16646979		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35731115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	26824441, 30107156		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	31838248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	34737791	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24384427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	17724140		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	17004110, 17452977, 17875715, 17895257, 19193721, 22118688, 26431436, 27696331, 28407692, 30015928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15861517, 17895257, 21113658, 21935711, 22118688, 26431436, 27696331, 28407692, 34993493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	20632031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	29512787		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	24429398	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cakut	Congenital anomalies of kidney and urinary tract	GENOMICS_ENGLAND_DG	7590254		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	26431436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	20530416		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	17895257	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23179403, 24573607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	17895257	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	20530416, 22447022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	34110955	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24299561	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26264810, 31576147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	33407844, 37840136	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	12919879, 18829350, 26123554	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilage Diseases	Cartilage disease	Pubtator	15094136	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	28152139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	15670622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	11789587, 15670622, 24618040		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19010887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19010887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21317922		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	24969562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	25390068	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	9565067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	15307210, 29304096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	12915382, 15307210, 18508541, 29229532, 29304096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	30537181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	19815628, 26112332, 29039539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	25662552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	12811818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	26986967, 30132514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	LHGDN	17478078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	18259822, 21523323, 28731124, 30679176		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16769811, 25340937, 29986714, 38063988	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	18259822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18259822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital contractural arachnodactyly	Pubtator	24969562	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital ocular coloboma (disorder)	Congenital ocular coloboma	BEFREE	24859618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital posterior urethral valves	Congenital Posterior Urethral Valves	BEFREE	26663319		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	20540029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30958112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	35627201	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18452219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	12919879, 28736908, 29980690, 31312184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating Diseases	BEFREE	30553833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dental Caries	Dental caries	Pubtator	26662797	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28186649, 28637038, 30380526, 31127659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	25378054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28186649, 28637038, 30380526, 30872412, 31127659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19453255, 28186649, 31394500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	25378054, 30988245, 32294702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	16899516, 19255250, 19303394, 19440953, 20546278, 23617393, 28765970, 30663414, 31655195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	LHGDN	16899516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	17895257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	25662552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocardial Fibroelastosis	Endocardial Fibroelastosis	BEFREE	28809397		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24077349, 34360647	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	CTD_human_DG	21063030		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	CTD_human_DG	21063030		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometriosis	Endometriosis	Pubtator	37047609	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21913019	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	17127702, 23539268, 25345787, 31435175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	12131877	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	19450457	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22539003, 25860932, 26546412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26546412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22539003, 25860932, 26546412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25860932, 28925495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28925495, 39373720	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	28815607	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	18496506	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28815607		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	35671049	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	35671049	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	37840136	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary gingival fibromatosis	Hereditary Gingival Fibromatosis	BEFREE	29490341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19440953, 27997722, 31394500		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperphosphatemia (disorder)	Hyperphosphatemia	BEFREE	29304096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	12740218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31542483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	BEFREE	12783783, 17264867, 23727413		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypospadias	Hypospadias	Pubtator	23727413	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypoxia	Hypoxia	Pubtator	29980690	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31542483		★★★★★ ★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	18560367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	12811818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	25966142, 27075568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	26218641, 26824865, 26929154, 28102712, 29367112, 29440560, 30341245, 30459239, 30872412		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	12594282	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	18508541, 19440953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	18508541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	20093492, 21080950, 25378054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	9649574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	20197625, 9649574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	12915382, 15307210, 29304096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12478660		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23179403, 26503415, 27193094, 30008908		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	19815628, 26112332, 29039539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	28062213		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	17522432, 21224856	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	22473939	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	21896235		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	21896235		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	24069261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	17004110, 17452977, 17875715, 17895257, 19193721, 22118688, 26431436, 27696331, 28407692, 30015928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	20530416, 22447022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26264810, 31576147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12539225, 16618753, 17644136, 17724140, 20126477, 20166979, 30015928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17013881, 19283074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20530416, 20540029, 26337467, 27422817, 29934328, 30015928		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19010887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	26986967, 30132514		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12792780, 16419056, 17909016, 18980801		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	17895257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	24069261		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	17522432, 18560367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17522432	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	18560367, 21673687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	18560367, 19735263, 21673687	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic melanoma	Metastatic Melanoma	BEFREE	15695386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	12539225		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple congenital anomalies	Multiple Congenital Anomalies	CLINVAR_DG	17003840, 20506283, 24429398		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	24080309, 30553833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30553833	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Duchenne	Duchenne muscular dystrophy	Pubtator	19453255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17724140, 17895257, 17962434, 18317448, 19010887, 20126477, 20225287, 20530416, 23179403, 25340937, 25860932, 26617798, 29449696, 30132514, 31524275, 31591478, 9565067 View all (2 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	27997722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	Pubtator	21080950	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	8227084	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16122479, 26617798		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	31524275		★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	21591998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	25662552	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	12919879, 26123554, 34608249	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	18829350, 26778533, 36830751	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	26590194	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	20362702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29371668, 31488155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	10627702, 10716620, 9069169, 9322936, 9565067		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	11986346, 20225287, 33034913	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	26264810, 31576147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37688374	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	19056927	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23651239	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	26889637	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Penile hypospadias	Penile Hypospadias	BEFREE	17264867, 23727413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	20520648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	20520648		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	31455237		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	26337467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	18349123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	LHGDN	18349123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	30383450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12539225, 16618753, 17644136, 17724140, 20126477, 20166979, 30015928		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15861517, 19283074, 25552920, 25858146	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	16126463		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17013881, 19283074		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	20126477, 9565067		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	Pubtator	33250156	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	17975199		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25733726, 28062213		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Cell Dysplasia	Renal dysplasia	BEFREE	22215634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	BEFREE	17450386, 22215634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	19741012, 23781031, 25176603, 26610487, 28923783, 31655195		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	20546278		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	29077160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	29077160		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sacroiliitis	Sacroiliitis	BEFREE	28303752		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Alveolar Soft Part	Sarcoma	Pubtator	33034913	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	33034913	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sirenomelia	Sirenomelia	BEFREE	23028704		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	22447022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	25518021	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Spondylolysis	Spondylolysis	BEFREE	17669279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	18514338		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	24299561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	30275196		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16367923, 21224856	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Subfertility	Subfertility	BEFREE	28324064		★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Microlithiasis	Testicular Microlithiasis	BEFREE	30027931		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	20039900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	37603701	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	22700475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	21896235		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	21896235		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uremia	Uremia	BEFREE	29304096		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neck Obstruction	Urinary bladder neck obstruction	Pubtator	28138557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	19010887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	32323730	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	17962434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Calcification	Vascular calcification	Pubtator	19453255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

BMP7 (bone morphogenetic protein 7)