ACTR3C (actin related protein 3C)

Gene

• Entrez ID: 653857
• Gene name: Actin related protein 3C
• Gene symbol: ACTR3C
• Synonyms (NCBI Gene): ARP11
• Chromosome: 7
• Chromosome location: 7q36.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT441271	hsa-miR-127-3p	HITS-CLIP	24374217
MIRT441272	hsa-miR-539-3p	HITS-CLIP	24374217
MIRT441270	hsa-miR-487a-3p	HITS-CLIP	24374217
MIRT441269	hsa-miR-379-3p	HITS-CLIP	24374217
MIRT441271	hsa-miR-127-3p	HITS-CLIP	24374217
MIRT441272	hsa-miR-539-3p	HITS-CLIP	24374217
MIRT441270	hsa-miR-487a-3p	HITS-CLIP	24374217
MIRT441269	hsa-miR-379-3p	HITS-CLIP	24374217
MIRT764708	hsa-miR-1251	CLIP-seq
MIRT764709	hsa-miR-190	CLIP-seq
MIRT764710	hsa-miR-190b	CLIP-seq
MIRT764711	hsa-miR-3064-3p	CLIP-seq
MIRT764712	hsa-miR-30a	CLIP-seq
MIRT764713	hsa-miR-30b	CLIP-seq
MIRT764714	hsa-miR-30c	CLIP-seq
MIRT764715	hsa-miR-30d	CLIP-seq
MIRT764716	hsa-miR-30e	CLIP-seq
MIRT764717	hsa-miR-4328	CLIP-seq
MIRT764718	hsa-miR-4495	CLIP-seq
MIRT764719	hsa-miR-4693-3p	CLIP-seq
MIRT764720	hsa-miR-4712-3p	CLIP-seq
MIRT764721	hsa-miR-4715-3p	CLIP-seq
MIRT764722	hsa-miR-4776-3p	CLIP-seq
MIRT764723	hsa-miR-518d-5p	CLIP-seq
MIRT764724	hsa-miR-519b-5p	CLIP-seq
MIRT764725	hsa-miR-519c-5p	CLIP-seq
MIRT764726	hsa-miR-520c-5p	CLIP-seq
MIRT764727	hsa-miR-526a	CLIP-seq
MIRT764728	hsa-miR-4662a-5p	CLIP-seq
MIRT764729	hsa-miR-4711-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003779	Function	Actin binding	IEA
GO:0005524	Function	ATP binding	IEA
GO:0051015	Function	Actin filament binding	IBA
GO:0070062	Component	Extracellular exosome	HDA	23533145

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9C0K3
• Protein name: Actin-related protein 3C (Actin-related protein 11)
• Protein function: May play a role in the suppression of metastatic potential in lung adenoma carcinoma cells.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00022	Actin	1 → 189	Actin	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in kidney, stomach, spleen, bone marrow, uterus, testis, placenta, skeletal muscle, mammary gland, lung, fetal liver, and fetal kidney, but not detected in small intestine, brain, and thymus. Expressed in low-metastatic lung
• Sequence:

  MFESFNVPGLYIAVQAVLALAASWTSRQVGERTLTGIVIDSGDGVTHVIPVAEGYVIGSC
  IKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKAIKEKYCYICPDIVKEFAKYDVDP
  QKWIKQYTGINAINQKKFVIDVGYERFLGPEIFFHPEFANPDSMESISDVVDEVIQNCPI
  DVRRPLYKMEQIPLSYPQGHGFHPLSPPFH

• Sequence length: 210

Pathways

KEGG:

Endocytosis
Tight junction
Fc gamma R-mediated phagocytosis
Regulation of actin cytoskeleton
Bacterial invasion of epithelial cells
Pathogenic Escherichia coli infection
Shigellosis
Salmonella infection
Yersinia infection

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LATE-ONSET ALZHEIMER'S DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	11162478, 14651955		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14651955		★☆☆☆☆ Found in Text Mining only