Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	653820
Gene name	Family with sequence similarity 72 member B
Gene symbol	FAM72B
Synonyms (NCBI Gene)	p17
Chromosome	1
Chromosome location	1p11.2

113

Show/Hide all (113)

miRTarBase ID	miRNA	Experiments
MIRT986906	hsa-let-7a	CLIP-seq
MIRT986907	hsa-let-7b	CLIP-seq
MIRT986908	hsa-let-7c	CLIP-seq
MIRT986909	hsa-let-7d	CLIP-seq
MIRT986910	hsa-let-7e	CLIP-seq
MIRT986911	hsa-let-7f	CLIP-seq
MIRT986912	hsa-let-7g	CLIP-seq
MIRT986913	hsa-let-7i	CLIP-seq
MIRT986914	hsa-miR-1	CLIP-seq
MIRT986915	hsa-miR-105	CLIP-seq
MIRT986916	hsa-miR-1225-5p	CLIP-seq
MIRT986917	hsa-miR-1245b-5p	CLIP-seq
MIRT986918	hsa-miR-1303	CLIP-seq
MIRT986919	hsa-miR-135a	CLIP-seq
MIRT986920	hsa-miR-135b	CLIP-seq
MIRT986921	hsa-miR-202	CLIP-seq
MIRT986922	hsa-miR-203	CLIP-seq
MIRT986923	hsa-miR-206	CLIP-seq
MIRT986924	hsa-miR-3065-5p	CLIP-seq
MIRT986925	hsa-miR-30a	CLIP-seq
MIRT986926	hsa-miR-30b	CLIP-seq
MIRT986927	hsa-miR-30c	CLIP-seq
MIRT986928	hsa-miR-30d	CLIP-seq
MIRT986929	hsa-miR-30e	CLIP-seq
MIRT986930	hsa-miR-3119	CLIP-seq
MIRT986931	hsa-miR-3125	CLIP-seq
MIRT986932	hsa-miR-3128	CLIP-seq
MIRT986933	hsa-miR-3129-3p	CLIP-seq
MIRT986934	hsa-miR-3142	CLIP-seq
MIRT986935	hsa-miR-3143	CLIP-seq
MIRT986936	hsa-miR-3189-5p	CLIP-seq
MIRT986937	hsa-miR-338-5p	CLIP-seq
MIRT986938	hsa-miR-3613-3p	CLIP-seq
MIRT986939	hsa-miR-365	CLIP-seq
MIRT986940	hsa-miR-369-3p	CLIP-seq
MIRT986941	hsa-miR-374a	CLIP-seq
MIRT986942	hsa-miR-374b	CLIP-seq
MIRT986943	hsa-miR-374c	CLIP-seq
MIRT986944	hsa-miR-3916	CLIP-seq
MIRT986945	hsa-miR-4264	CLIP-seq
MIRT986946	hsa-miR-4458	CLIP-seq
MIRT986947	hsa-miR-4464	CLIP-seq
MIRT986948	hsa-miR-4495	CLIP-seq
MIRT986949	hsa-miR-4500	CLIP-seq
MIRT986950	hsa-miR-4666-3p	CLIP-seq
MIRT986951	hsa-miR-4699-3p	CLIP-seq
MIRT986952	hsa-miR-4705	CLIP-seq
MIRT986953	hsa-miR-4748	CLIP-seq
MIRT986954	hsa-miR-4758-3p	CLIP-seq
MIRT986955	hsa-miR-520d-5p	CLIP-seq
MIRT986956	hsa-miR-524-5p	CLIP-seq
MIRT986957	hsa-miR-543	CLIP-seq
MIRT986958	hsa-miR-548aa	CLIP-seq
MIRT986959	hsa-miR-548ae	CLIP-seq
MIRT986960	hsa-miR-548aj	CLIP-seq
MIRT986961	hsa-miR-548am	CLIP-seq
MIRT986962	hsa-miR-548x	CLIP-seq
MIRT986963	hsa-miR-563	CLIP-seq
MIRT986964	hsa-miR-590-3p	CLIP-seq
MIRT986965	hsa-miR-613	CLIP-seq
MIRT986966	hsa-miR-622	CLIP-seq
MIRT986967	hsa-miR-655	CLIP-seq
MIRT986968	hsa-miR-873	CLIP-seq
MIRT986969	hsa-miR-877	CLIP-seq
MIRT986970	hsa-miR-892b	CLIP-seq
MIRT986971	hsa-miR-9	CLIP-seq
MIRT986972	hsa-miR-98	CLIP-seq
MIRT986906	hsa-let-7a	CLIP-seq
MIRT986907	hsa-let-7b	CLIP-seq
MIRT986908	hsa-let-7c	CLIP-seq
MIRT986909	hsa-let-7d	CLIP-seq
MIRT986910	hsa-let-7e	CLIP-seq
MIRT986911	hsa-let-7f	CLIP-seq
MIRT986912	hsa-let-7g	CLIP-seq
MIRT986913	hsa-let-7i	CLIP-seq
MIRT986921	hsa-miR-202	CLIP-seq
MIRT986933	hsa-miR-3129-3p	CLIP-seq
MIRT986941	hsa-miR-374a	CLIP-seq
MIRT986942	hsa-miR-374b	CLIP-seq
MIRT986946	hsa-miR-4458	CLIP-seq
MIRT986949	hsa-miR-4500	CLIP-seq
MIRT986952	hsa-miR-4705	CLIP-seq
MIRT1992494	hsa-miR-4719	CLIP-seq
MIRT1992495	hsa-miR-4729	CLIP-seq
MIRT1992496	hsa-miR-513b	CLIP-seq
MIRT986958	hsa-miR-548aa	CLIP-seq
MIRT986964	hsa-miR-590-3p	CLIP-seq
MIRT986970	hsa-miR-892b	CLIP-seq
MIRT986972	hsa-miR-98	CLIP-seq
MIRT986906	hsa-let-7a	CLIP-seq
MIRT986907	hsa-let-7b	CLIP-seq
MIRT986908	hsa-let-7c	CLIP-seq
MIRT986909	hsa-let-7d	CLIP-seq
MIRT986910	hsa-let-7e	CLIP-seq
MIRT986911	hsa-let-7f	CLIP-seq
MIRT986912	hsa-let-7g	CLIP-seq
MIRT986913	hsa-let-7i	CLIP-seq
MIRT986921	hsa-miR-202	CLIP-seq
MIRT986933	hsa-miR-3129-3p	CLIP-seq
MIRT986945	hsa-miR-4264	CLIP-seq
MIRT986946	hsa-miR-4458	CLIP-seq
MIRT986949	hsa-miR-4500	CLIP-seq
MIRT2226456	hsa-miR-4668-3p	CLIP-seq
MIRT986951	hsa-miR-4699-3p	CLIP-seq
MIRT986952	hsa-miR-4705	CLIP-seq
MIRT2226457	hsa-miR-4728-3p	CLIP-seq
MIRT1992495	hsa-miR-4729	CLIP-seq
MIRT986958	hsa-miR-548aa	CLIP-seq
MIRT2226458	hsa-miR-605	CLIP-seq
MIRT986966	hsa-miR-622	CLIP-seq
MIRT986970	hsa-miR-892b	CLIP-seq
MIRT986971	hsa-miR-9	CLIP-seq
MIRT986972	hsa-miR-98	CLIP-seq

Show/Hide all (4)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA

MIM	HGNC	e!Ensembl
614711	24805	ENSG00000188610

Q86X60

Protein name

Protein FAM72B

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF14976	FAM72	5 → 149	FAM72 protein	Family

Sequence

MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCY
FTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLPSCNNGHFWMFHSQAVYDINRLDSTGV
NILLWGNLPEIEESTDEDVLNISAEECIR

Sequence length

149

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Brain Diseases	Brain disease	Pubtator	10482626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	30390010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	10482626	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hemophilia B	Hemophilia	BEFREE	8573375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	28284560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	24736615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	26578780, 28747658, 33093643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	30261551		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12010812, 28072889		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11973654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19513564, 29907572		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	23202800, 23900679, 26773045		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	28092842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	30390010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	38226611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	21185199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	18997086, 28241318, 30664207		★★★★★ ★☆☆☆☆ Found in Text Mining only

FAM72B (family with sequence similarity 72 member B)