Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	653509
Gene name	Surfactant protein A1
Gene symbol	SFTPA1
Synonyms (NCBI Gene)	COLEC4ILD1PSAPPSP-APSPASFTP1SFTPA1BSP-ASP-A1SP-A1 betaSP-A1 deltaSP-A1 epsilonSP-A1 gammaSPASPA1
Chromosome	10
Chromosome location	10q22.3
Summary	This gene encodes a lung surfactant protein that is a member of a subfamily of C-type lectins called collectins. The encoded protein binds specific carbohydrate moieties found on lipids and on the surface of microorganisms. This protein plays an essential

Show/Hide all (85)

miRTarBase ID	miRNA	Experiments	Reference
MIRT546959	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT546958	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT546957	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT546956	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT546955	hsa-miR-3666	PAR-CLIP	21572407
MIRT546954	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT546953	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT546951	hsa-miR-4295	PAR-CLIP	21572407
MIRT546952	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT546950	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT546949	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT546948	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT546947	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT546946	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT546945	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT546944	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT546942	hsa-miR-4473	PAR-CLIP	21572407
MIRT546943	hsa-miR-548aw	PAR-CLIP	21572407
MIRT546941	hsa-miR-3591-5p	PAR-CLIP	21572407
MIRT546959	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT546958	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT546957	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT546956	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT546955	hsa-miR-3666	PAR-CLIP	21572407
MIRT546954	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT546953	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT546951	hsa-miR-4295	PAR-CLIP	21572407
MIRT546952	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT546950	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT546949	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT546948	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT546947	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT546946	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT546945	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT546944	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT546942	hsa-miR-4473	PAR-CLIP	21572407
MIRT546943	hsa-miR-548aw	PAR-CLIP	21572407
MIRT546941	hsa-miR-3591-5p	PAR-CLIP	21572407
MIRT546959	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT546958	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT546957	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT546956	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT546955	hsa-miR-3666	PAR-CLIP	21572407
MIRT546954	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT546953	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT546951	hsa-miR-4295	PAR-CLIP	21572407
MIRT546952	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT546950	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT546949	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT546948	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT546947	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT546946	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT546945	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT546944	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT546942	hsa-miR-4473	PAR-CLIP	21572407
MIRT546943	hsa-miR-548aw	PAR-CLIP	21572407
MIRT546941	hsa-miR-3591-5p	PAR-CLIP	21572407
MIRT546959	hsa-miR-19b-3p	PAR-CLIP	21572407
MIRT546958	hsa-miR-19a-3p	PAR-CLIP	21572407
MIRT546957	hsa-miR-301a-3p	PAR-CLIP	21572407
MIRT546956	hsa-miR-454-3p	PAR-CLIP	21572407
MIRT546955	hsa-miR-3666	PAR-CLIP	21572407
MIRT546954	hsa-miR-130a-3p	PAR-CLIP	21572407
MIRT546953	hsa-miR-130b-3p	PAR-CLIP	21572407
MIRT546951	hsa-miR-4295	PAR-CLIP	21572407
MIRT546952	hsa-miR-301b-3p	PAR-CLIP	21572407
MIRT546950	hsa-miR-548c-3p	PAR-CLIP	21572407
MIRT546949	hsa-miR-548aj-5p	PAR-CLIP	21572407
MIRT546948	hsa-miR-548f-5p	PAR-CLIP	21572407
MIRT546947	hsa-miR-548g-5p	PAR-CLIP	21572407
MIRT546946	hsa-miR-548x-5p	PAR-CLIP	21572407
MIRT546945	hsa-miR-1468-3p	PAR-CLIP	21572407
MIRT546944	hsa-miR-4671-3p	PAR-CLIP	21572407
MIRT546942	hsa-miR-4473	PAR-CLIP	21572407
MIRT546943	hsa-miR-548aw	PAR-CLIP	21572407
MIRT546941	hsa-miR-3591-5p	PAR-CLIP	21572407
MIRT1342117	hsa-miR-2110	CLIP-seq
MIRT1342118	hsa-miR-3115	CLIP-seq
MIRT1342119	hsa-miR-3675-5p	CLIP-seq
MIRT1342120	hsa-miR-4271	CLIP-seq
MIRT1342121	hsa-miR-4276	CLIP-seq
MIRT1342122	hsa-miR-4697-3p	CLIP-seq
MIRT1342123	hsa-miR-4725-3p	CLIP-seq
MIRT1922969	hsa-miR-339-5p	CLIP-seq
MIRT1922969	hsa-miR-339-5p	CLIP-seq

Show/Hide all (3)

Transcription factor	Regulation	Reference
NFKB1	Unknown	12040027
NKX2-1	Unknown	12040027
RELA	Unknown	12040027

Show/Hide all (16)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005319	Function	Lipid transporter activity	TAS	2995821
GO:0005515	Function	Protein binding	IPI	10101009, 15845487
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005581	Component	Collagen trimer	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005771	Component	Multivesicular body	IBA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS
GO:0006869	Process	Lipid transport	IEA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0008228	Process	Opsonization	IMP	21123169
GO:0030246	Function	Carbohydrate binding	IEA
GO:0042599	Component	Lamellar body	IEA
GO:0042599	Component	Lamellar body	TAS
GO:0045334	Component	Clathrin-coated endocytic vesicle	IEA
GO:0045334	Component	Clathrin-coated endocytic vesicle	TAS

MIM	HGNC	e!Ensembl
178630	10798	ENSG00000122852

Q8IWL2

Protein name

Pulmonary surfactant-associated protein A1 (PSP-A) (PSPA) (SP-A) (SP-A1) (35 kDa pulmonary surfactant-associated protein) (Alveolar proteinosis protein) (Collectin-4)

Protein function

In presence of calcium ions, it binds to surfactant phospholipids and contributes to lower the surface tension at the air-liquid interface in the alveoli of the mammalian lung and is essential for normal respiration. Enhances the expression of M

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00059	Lectin_C	144 → 248	Lectin C-type domain	Domain

Sequence

MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPM
GPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQ
TRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLY
SRLTICEF

Sequence length

248

Interactions

View interactions

	KEGG		Reactome
	Phagosome Pertussis		Toll Like Receptor 4 (TLR4) Cascade Toll Like Receptor TLR1:TLR2 Cascade Signal regulatory protein family interactions Surfactant metabolism Regulation of TLR by endogenous ligand Defective CSF2RB causes pulmonary surfactant metabolism dysfunction 5 (SMDP5) Defective CSF2RA causes pulmonary surfactant metabolism dysfunction 4 (SMDP4)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Interstitial lung disease 1	Pathogenic	rs2132140058, rs2132140607, rs1215316727, rs2132139965	RCV001780090 RCV001780091 RCV001784078 RCV001784079	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BRONCHOPULMONARY DYSPLASIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHROMOSOME 16P11.2 DELETION SYNDROME, 593-KB	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC PULMONARY FIBROSIS	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Interstitial lung disease 2	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
LUNG DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Proximal 16p11.2 microdeletion syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary fibrosis, idiopathic, susceptibility to	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Respiratory distress associated with prematurity	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SFTPA1-related disorder	Benign; Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (109)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	15996209, 17237283, 25514367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	26792177, 28089356, 29956575, 9375708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Allergic rhinitis (disorder)	Allergic rhinitis	BEFREE	23406594		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	30076539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	12892713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	2346784	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28130491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	16489709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16489709	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	16884531, 21784968		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	16884531, 17407567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	23794464	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28130491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	24098648, 33267857	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	12892713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	8663395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiectasis	Bronchiectasis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis	Bronchiolitis	BEFREE	17142161, 24362687		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	LHGDN	18022079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopneumonia	Bronchopneumonia	Pubtator	35905206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	15102713, 17142161, 17726703, 7881683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	17264398	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of lung	Lung carcinoma	BEFREE	14729646, 15996209, 17549420, 26792177, 28871124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28130491		★★★★★ ★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	21310059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	24098648	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30907155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30243748		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	15696492		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	19797132, 24093802		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic sinusitis	Sinusitis	BEFREE	17599561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	28068755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	30076539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital diaphragmatic hernia	Congenital diaphragmatic hernia	BEFREE	12904592		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	11597919		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Ulcer	Corneal Ulcer	BEFREE	17724171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cough	Cough	Pubtator	17407567	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	17599561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	16356787, 30333828	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	16429424, 17189324, 17599561, 30333828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29156994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Elliptocytosis 1	Hereditary elliptocytosis	Pubtator	9163587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Elliptocytosis Hereditary	Hereditary elliptocytosis	Pubtator	3922449, 9163587	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	GENOMICS_ENGLAND_DG	22884059		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	ORPHANET_DG	13680361		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamman-Rich syndrome	Hamman-Rich syndrome	BEFREE	26792177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	15310461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	BEFREE	29997245		★★★★★ ★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	16162765		★★★★★ ★☆☆☆☆ Found in Text Mining only
Honeycomb lung	Honeycomb lung	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	BEFREE	31127529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	8559602		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	13680361, 19347046, 22884059, 26792177, 28556957, 28591049, 31601679		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	ORPHANET_DG	13680361		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic pulmonary fibrosis	Pulmonary Fibrosis	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	21435274, 35720392	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	22015564	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	GENOMICS_ENGLAND_DG	22884059		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Impaired cognition	Impaired Cognition	BEFREE	30076539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	28879780		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	31263429, 31653884		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28068755		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	10689550, 11381191, 21575284, 27337142, 28620154, 36135709	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung diseases	Lung Diseases	BEFREE	11381191, 12452477, 16429424, 25442010, 29763900, 9813381		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases Interstitial	Lung disease	Pubtator	21435274, 22015564, 24400879, 32855221, 33267857, 33526882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	11445799, 28130491, 28591049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Obstructive	Lung Diseases	BEFREE	24092637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	16085219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	16085219, 26292924, 32855221, 38575158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphangioleiomyomatosis	Lymphangiomyomatosis	BEFREE	29393256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	14729646, 15996209, 17549420, 26792177, 28871124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25514367, 26792177		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	10456925	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	12892713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12892713		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	BEFREE	1218374		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	17599561		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12892713, 2249989, 29867072, 31494736, 9205112		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30076539		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16061856, 16085219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteomyelitis	Osteomyelitis	Pubtator	31871129	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Otitis Media	Otitis media	BEFREE	16884531		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	BEFREE	9375708		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	28620154	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24168624	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Pulmonary alveolar proteinosis	Pubtator	15466251	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Alveolar Proteinosis	Alveolar proteinosis	BEFREE	17189324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	11589345, 23794464	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	32049827	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	12060565	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23926107, 26792177, 29997245, 31601679		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyelonephritis	Pyelonephritis	BEFREE	20448439		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiration Disorders	Respiration Disorders	BEFREE	26792177, 9813381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome	Respiratory Distress Syndrome	BEFREE	12667827, 16162765, 26061924, 9475280, 9813381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	12667827, 12935621, 14575179, 16162765, 26061924, 9475280, 9813381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Newborn	Congenital alveolar dysplasia	BEFREE	10762543, 11063734, 11702216, 12452477, 12483294, 12537318, 12667827, 12947025, 12952021, 15102713, 16162765, 17142161, 17524024, 23038062, 26061924 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Failure	Respiratory Failure	BEFREE	29997245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	25025725, 33526882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory Tract Diseases	BEFREE	9813381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	32450935	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhinitis Allergic	Rhinitis	Pubtator	34028080	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rickets	Rickets	BEFREE	2015415		★★★★★ ★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28591009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	16085219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	36473332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	29268512		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitamin D-Resistant Rickets, X-Linked	Vitamin D-Dependent Rickets	BEFREE	2015415		★★★★★ ★☆☆☆☆ Found in Text Mining only

SFTPA1 (surfactant protein A1)