SLC6A4 (solute carrier family 6 member 4)

Gene

• Entrez ID: 6532
• Gene name: Solute carrier family 6 member 4
• Gene symbol: SLC6A4
• Synonyms (NCBI Gene): 5-HTT, 5-HTTLPR, 5HTT, HTT, OCD1, SERT, SERT1, hSERT
• Chromosome: 17
• Chromosome location: 17q11.2
• Summary: This gene encodes an integral membrane protein that transports the neurotransmitter serotonin from synaptic spaces into presynaptic neurons. The encoded protein terminates the action of serotonin and recycles it in a sodium-dependent manner. This protein

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs28914832	T>C,G	Risk-factor	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT018862	hsa-miR-335-5p	Microarray	18185580
MIRT053620	hsa-miR-16-5p	qRT-PCR, Western blot	22940131
MIRT438132	hsa-miR-135a-5p	Luciferase reporter assay	24952960
MIRT438132	hsa-miR-135a-5p	Luciferase reporter assay	24952960
MIRT699293	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT699292	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT699291	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT699290	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT699289	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT699288	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT699287	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT699286	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT699285	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT699284	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT699283	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT699282	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT699281	hsa-miR-302e	HITS-CLIP	23313552
MIRT699280	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT699279	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT699278	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT699277	hsa-miR-520b	HITS-CLIP	23313552
MIRT699276	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT699275	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT699274	hsa-miR-520e	HITS-CLIP	23313552
MIRT699273	hsa-miR-552-3p	HITS-CLIP	23313552
MIRT699272	hsa-miR-4418	HITS-CLIP	23313552
MIRT699271	hsa-miR-509-3-5p	HITS-CLIP	23313552
MIRT699270	hsa-miR-509-5p	HITS-CLIP	23313552
MIRT699269	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT699268	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT699267	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT699266	hsa-miR-520h	HITS-CLIP	23313552
MIRT699265	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT699264	hsa-miR-3934-5p	HITS-CLIP	23313552
MIRT699263	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT699262	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT699261	hsa-miR-3130-3p	HITS-CLIP	23313552
MIRT639481	hsa-miR-1184	HITS-CLIP	23313552
MIRT699260	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT699259	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT699258	hsa-miR-5702	HITS-CLIP	23313552
MIRT699257	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT699256	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT699255	hsa-miR-5095	HITS-CLIP	23313552
MIRT699254	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT699253	hsa-miR-937-5p	HITS-CLIP	23313552
MIRT699252	hsa-miR-7156-3p	HITS-CLIP	23313552
MIRT699251	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT639490	hsa-miR-6507-3p	HITS-CLIP	23824327
MIRT639489	hsa-miR-1264	HITS-CLIP	23824327
MIRT639488	hsa-miR-142-5p	HITS-CLIP	23824327
MIRT639487	hsa-miR-5590-3p	HITS-CLIP	23824327
MIRT639486	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT639484	hsa-miR-4287	HITS-CLIP	23824327
MIRT639483	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT639482	hsa-miR-3158-5p	HITS-CLIP	23824327
MIRT639481	hsa-miR-1184	HITS-CLIP	23824327
MIRT639480	hsa-miR-1205	HITS-CLIP	23824327
MIRT639479	hsa-miR-17-3p	HITS-CLIP	23824327
MIRT639478	hsa-miR-2467-3p	HITS-CLIP	23824327
MIRT639477	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT639476	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT639475	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT639474	hsa-miR-3678-3p	HITS-CLIP	23824327
MIRT639473	hsa-miR-544a	HITS-CLIP	23824327
MIRT639490	hsa-miR-6507-3p	HITS-CLIP	23824327
MIRT639489	hsa-miR-1264	HITS-CLIP	23824327
MIRT639488	hsa-miR-142-5p	HITS-CLIP	23824327
MIRT639487	hsa-miR-5590-3p	HITS-CLIP	23824327
MIRT639486	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT639485	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT639484	hsa-miR-4287	HITS-CLIP	23824327
MIRT639483	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT639482	hsa-miR-3158-5p	HITS-CLIP	23824327
MIRT639481	hsa-miR-1184	HITS-CLIP	23824327
MIRT639480	hsa-miR-1205	HITS-CLIP	23824327
MIRT639479	hsa-miR-17-3p	HITS-CLIP	23824327
MIRT639478	hsa-miR-2467-3p	HITS-CLIP	23824327
MIRT639477	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT639476	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT639475	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT639474	hsa-miR-3678-3p	HITS-CLIP	23824327
MIRT639473	hsa-miR-544a	HITS-CLIP	23824327
MIRT699293	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT699292	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT699291	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT699290	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT699289	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT699288	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT699287	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT699286	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT699285	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT699284	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT699283	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT699282	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT699281	hsa-miR-302e	HITS-CLIP	23313552
MIRT699280	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT699279	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT699278	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT699277	hsa-miR-520b	HITS-CLIP	23313552
MIRT699276	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT699275	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT699274	hsa-miR-520e	HITS-CLIP	23313552
MIRT699273	hsa-miR-552-3p	HITS-CLIP	23313552
MIRT699272	hsa-miR-4418	HITS-CLIP	23313552
MIRT699271	hsa-miR-509-3-5p	HITS-CLIP	23313552
MIRT699270	hsa-miR-509-5p	HITS-CLIP	23313552
MIRT699269	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT699268	hsa-miR-6504-3p	HITS-CLIP	23313552
MIRT699267	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT699266	hsa-miR-520h	HITS-CLIP	23313552
MIRT699265	hsa-miR-6890-3p	HITS-CLIP	23313552
MIRT699264	hsa-miR-3934-5p	HITS-CLIP	23313552
MIRT699263	hsa-miR-186-3p	HITS-CLIP	23313552
MIRT699262	hsa-miR-150-5p	HITS-CLIP	23313552
MIRT699261	hsa-miR-3130-3p	HITS-CLIP	23313552
MIRT639481	hsa-miR-1184	HITS-CLIP	23313552
MIRT699260	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT699259	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT699258	hsa-miR-5702	HITS-CLIP	23313552
MIRT699257	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT699256	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT699255	hsa-miR-5095	HITS-CLIP	23313552
MIRT699254	hsa-miR-7151-3p	HITS-CLIP	23313552
MIRT699253	hsa-miR-937-5p	HITS-CLIP	23313552
MIRT699252	hsa-miR-7156-3p	HITS-CLIP	23313552
MIRT699251	hsa-miR-5089-5p	HITS-CLIP	23313552
MIRT639490	hsa-miR-6507-3p	HITS-CLIP	23824327
MIRT639489	hsa-miR-1264	HITS-CLIP	23824327
MIRT639488	hsa-miR-142-5p	HITS-CLIP	23824327
MIRT639487	hsa-miR-5590-3p	HITS-CLIP	23824327
MIRT639486	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT639484	hsa-miR-4287	HITS-CLIP	23824327
MIRT639483	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT639482	hsa-miR-3158-5p	HITS-CLIP	23824327
MIRT639481	hsa-miR-1184	HITS-CLIP	23824327
MIRT639480	hsa-miR-1205	HITS-CLIP	23824327
MIRT639479	hsa-miR-17-3p	HITS-CLIP	23824327
MIRT639478	hsa-miR-2467-3p	HITS-CLIP	23824327
MIRT639477	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT639476	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT639475	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT639474	hsa-miR-3678-3p	HITS-CLIP	23824327
MIRT639473	hsa-miR-544a	HITS-CLIP	23824327
MIRT639490	hsa-miR-6507-3p	HITS-CLIP	23824327
MIRT639489	hsa-miR-1264	HITS-CLIP	23824327
MIRT639488	hsa-miR-142-5p	HITS-CLIP	23824327
MIRT639487	hsa-miR-5590-3p	HITS-CLIP	23824327
MIRT639486	hsa-miR-5088-3p	HITS-CLIP	23824327
MIRT639485	hsa-miR-1237-3p	HITS-CLIP	23824327
MIRT639484	hsa-miR-4287	HITS-CLIP	23824327
MIRT639483	hsa-miR-4685-3p	HITS-CLIP	23824327
MIRT639482	hsa-miR-3158-5p	HITS-CLIP	23824327
MIRT639481	hsa-miR-1184	HITS-CLIP	23824327
MIRT639480	hsa-miR-1205	HITS-CLIP	23824327
MIRT639479	hsa-miR-17-3p	HITS-CLIP	23824327
MIRT639478	hsa-miR-2467-3p	HITS-CLIP	23824327
MIRT639477	hsa-miR-4691-5p	HITS-CLIP	23824327
MIRT639476	hsa-miR-6792-3p	HITS-CLIP	23824327
MIRT639475	hsa-miR-6749-3p	HITS-CLIP	23824327
MIRT639474	hsa-miR-3678-3p	HITS-CLIP	23824327
MIRT639473	hsa-miR-544a	HITS-CLIP	23824327
MIRT1366351	hsa-miR-141	CLIP-seq
MIRT1366352	hsa-miR-146a	CLIP-seq
MIRT1366353	hsa-miR-146b-5p	CLIP-seq
MIRT1366354	hsa-miR-200a	CLIP-seq
MIRT1366355	hsa-miR-27a	CLIP-seq
MIRT1366356	hsa-miR-27b	CLIP-seq
MIRT1366357	hsa-miR-3140-5p	CLIP-seq
MIRT1366358	hsa-miR-3190	CLIP-seq
MIRT1366359	hsa-miR-3616-5p	CLIP-seq
MIRT1366360	hsa-miR-3647-5p	CLIP-seq
MIRT1366361	hsa-miR-371b-5p	CLIP-seq
MIRT1366362	hsa-miR-3919	CLIP-seq
MIRT1366363	hsa-miR-3925-5p	CLIP-seq
MIRT1366364	hsa-miR-3938	CLIP-seq
MIRT1366365	hsa-miR-4698	CLIP-seq
MIRT1366366	hsa-miR-4729	CLIP-seq
MIRT1366367	hsa-miR-4762-3p	CLIP-seq
MIRT1366368	hsa-miR-4789-5p	CLIP-seq
MIRT1366369	hsa-miR-4795-5p	CLIP-seq
MIRT1366370	hsa-miR-4797-5p	CLIP-seq
MIRT1366371	hsa-miR-4799-5p	CLIP-seq
MIRT1366372	hsa-miR-499a-5p	CLIP-seq
MIRT1366373	hsa-miR-513a-3p	CLIP-seq
MIRT1366374	hsa-miR-513a-5p	CLIP-seq
MIRT1366375	hsa-miR-573	CLIP-seq
MIRT1366376	hsa-miR-579	CLIP-seq
MIRT2108742	hsa-miR-2110	CLIP-seq
MIRT2108743	hsa-miR-3153	CLIP-seq
MIRT2108744	hsa-miR-3173-3p	CLIP-seq
MIRT2108745	hsa-miR-4271	CLIP-seq
MIRT2108746	hsa-miR-4667-5p	CLIP-seq
MIRT2108747	hsa-miR-4695-5p	CLIP-seq
MIRT2108748	hsa-miR-4700-5p	CLIP-seq
MIRT2108749	hsa-miR-4725-3p	CLIP-seq
MIRT2332378	hsa-miR-4282	CLIP-seq
MIRT1366372	hsa-miR-499a-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CTCF	Unknown	15229244;17360901;21309950;23765727
YBX1	Unknown	15229244;17360901;23765727

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IEA
GO:0005178	Function	Integrin binding	IDA	18317590
GO:0005261	Function	Monoatomic cation channel activity	IEA
GO:0005261	Function	Monoatomic cation channel activity	ISS
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	IEA
GO:0005326	Function	Neurotransmitter transmembrane transporter activity	ISS
GO:0005335	Function	Serotonin:sodium:chloride symporter activity	IBA
GO:0005335	Function	Serotonin:sodium:chloride symporter activity	IDA	8987735, 10407194, 17506858
GO:0005335	Function	Serotonin:sodium:chloride symporter activity	IEA
GO:0005335	Function	Serotonin:sodium:chloride symporter activity	IMP	12869649
GO:0005335	Function	Serotonin:sodium:chloride symporter activity	TAS
GO:0005515	Function	Protein binding	IPI	11343649, 12177201, 16870614, 16882008, 18317590
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	12869649, 16870614, 17506858, 18317590
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005925	Component	Focal adhesion	IEA
GO:0005925	Component	Focal adhesion	ISS
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006836	Process	Neurotransmitter transport	ISS
GO:0006837	Process	Serotonin transport	IEA
GO:0006865	Process	Amino acid transport	IBA
GO:0007584	Process	Response to nutrient	IEA
GO:0007613	Process	Memory	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008504	Function	Monoamine transmembrane transporter activity	IDA	16024787
GO:0008504	Function	Monoamine transmembrane transporter activity	IEA
GO:0008504	Function	Monoamine transmembrane transporter activity	ISS
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009636	Process	Response to toxic substance	IDA	17575980
GO:0010008	Component	Endosome membrane	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0012505	Component	Endomembrane system	IDA	17506858
GO:0012505	Component	Endomembrane system	IEA
GO:0014064	Process	Positive regulation of serotonin secretion	IEA
GO:0015297	Function	Antiporter activity	IDA	27756841
GO:0015297	Function	Antiporter activity	IEA
GO:0015844	Process	Monoamine transport	IDA	16024787
GO:0016020	Component	Membrane	IEA
GO:0017075	Function	Syntaxin-1 binding	IEA
GO:0019811	Function	Cocaine binding	IEA
GO:0021941	Process	Negative regulation of cerebellar granule cell precursor proliferation	IEA
GO:0031402	Function	Sodium ion binding	IDA	34851672
GO:0032227	Process	Negative regulation of synaptic transmission, dopaminergic	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IBA
GO:0042310	Process	Vasoconstriction	IEA
GO:0042734	Component	Presynaptic membrane	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0043005	Component	Neuron projection	IEA
GO:0045121	Component	Membrane raft	IDA	16870614
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0045202	Component	Synapse	ISS
GO:0045211	Component	Postsynaptic membrane	IEA
GO:0045665	Process	Negative regulation of neuron differentiation	IEA
GO:0045787	Process	Positive regulation of cell cycle	IEA
GO:0046621	Process	Negative regulation of organ growth	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048148	Process	Behavioral response to cocaine	IEA
GO:0048484	Process	Enteric nervous system development	IEA
GO:0048854	Process	Brain morphogenesis	IEA
GO:0050998	Function	Nitric-oxide synthase binding	IEA
GO:0051015	Function	Actin filament binding	IEA
GO:0051015	Function	Actin filament binding	ISS
GO:0051378	Function	Serotonin binding	IBA
GO:0051378	Function	Serotonin binding	IDA	34851672
GO:0051610	Process	Serotonin uptake	IBA
GO:0051610	Process	Serotonin uptake	IDA	8987735, 16870614, 17506858, 18317590, 21730057, 27756841
GO:0051610	Process	Serotonin uptake	IEA
GO:0051610	Process	Serotonin uptake	IMP	7681602
GO:0051610	Process	Serotonin uptake	ISS
GO:0051610	Process	Serotonin uptake	TAS
GO:0051899	Process	Membrane depolarization	IEA
GO:0051899	Process	Membrane depolarization	ISS
GO:0060179	Process	Male mating behavior	IEA
GO:0070161	Component	Anchoring junction	IEA
GO:0070527	Process	Platelet aggregation	IEA
GO:0070527	Process	Platelet aggregation	ISS
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0071321	Process	Cellular response to cGMP	IEA
GO:0090067	Process	Regulation of thalamus size	IMP	18378990
GO:0098810	Process	Neurotransmitter reuptake	IEA
GO:0099154	Component	Serotonergic synapse	IEA
GO:1990708	Process	Conditioned place preference	IEA

Other IDs

• MIM: 182138
• HGNC: 11050
• e!Ensembl: ENSG00000108576

Protein

• UniProt ID: P31645
• Protein name: Sodium-dependent serotonin transporter (SERT) (5HT transporter) (5HTT) (Solute carrier family 6 member 4)
• Protein function: Serotonin transporter that cotransports serotonin with one Na(+) ion in exchange for one K(+) ion and possibly one proton in an overall electroneutral transport cycle. Transports serotonin across the plasma membrane from the extracellular compar
• PDB: 5I6X, 5I6Z, 5I71, 5I73, 5I74, 5I75, 6AWN, 6AWO, 6AWP, 6AWQ, 6DZV, 6DZW, 6DZY, 6DZZ, 6VRH, 6VRK, 6VRL, 6W2B, 6W2C, 7LI6, 7LI7, 7LI8, 7LI9, 7LIA, 7LWD, 7MGW, 7TXT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF03491	5HT_transport_N	24 → 64	Serotonin (5-HT) neurotransmitter transporter, N-terminus	Family
  PF00209	SNF	79 → 600	Sodium:neurotransmitter symporter family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in platelets (at protein level). {ECO:0000269|PubMed:17506858}.
• Sequence:

  METTPLNSQKQLSACEDGEDCQENGVLQKVVPTPGDKVESGQISNGYSAVPSPGAGDDTR
  HSIPATTTTLVAELHQGERETWGKKVDFLLSVIGYAVDLGNVWRFPYICYQNGGGAFLLP
  YTIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYAICIIAFYIASYYNTIM
  AWALYYLISSFTDQLPWTSCKNSWNTGNCTNYFSEDNITWTLHSTSPAEEFYTRHVLQIH
  RSKGLQDLGGISWQLALCIMLIFTVIYFSIWKGVKTSGKVVWVTATFPYIILSVLLVRGA
  TLPGAWRGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQD
  ALVTSVVNCMTSFVSGFVIFTVLGYMAEMRNEDVSEVAKDAGPSLLFITYAEAIANMPAS
  TFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHVWAKRRERFVLAVVITCFFGSLVT
  LTFGGAYVVKLLEEYATGPAVLTVALIEAVAVSWFYGITQFCRDVKEMLGFSPGWFWRIC
  WVAISPLFLLFIICSFLMSPPQLRLFQYNYPYWSIILGYCIGTSSFICIPTYIAYRLIIT
  PGTFKERIIKSITPETPTEIPCGDIRLNAV

• Sequence length: 630

Pathways

KEGG:

Synaptic vesicle cycle
Serotonergic synapse

Reactome:

Serotonin clearance from the synaptic cleft

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Obsessive-compulsive disorder	Likely pathogenic	rs2143013401	RCV001731115	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMPHETAMINE OR RELATED ACTING SYMPATHOMIMETIC ABUSE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMPHETAMINE-RELATED DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANHEDONIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASPERGER SYNDROME	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTHMA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autism spectrum disorder	Likely benign	ClinVar CTD, ClinGen CTD, ClinGen	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behavior disorder	Uncertain significance; Likely benign; Benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BEHAVIOR DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR I DISORDER, MOST RECENT EPISODE MANIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANNABIS USE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC FATIGUE SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE AIRWAY DISEASE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGESTIVE HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSED MOOD	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, BIPOLAR	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSION, POSTPARTUM	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, MAJOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER, TREATMENT-RESISTANT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSTHYMIC DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENERALIZED ANXIETY DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION, PULMONARY	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSION, SINGLE EPISODE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MEMORY DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED BIPOLAR I DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obsessive-compulsive disorder, susceptibility to	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RECURRENT MAJOR DEPRESSIVE EPISODES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEASONAL AFFECTIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Serotonin transporter activity, increased/decreased	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC6A4-related disorder	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLEEP APNEA, OBSTRUCTIVE	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE WITHDRAWAL SYNDROME	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	9536080		★☆☆☆☆ Found in Text Mining only
Affective Disorders, Psychotic	Affective Psychosis	PSYGENET_DG	18264772, 20031235		★☆☆☆☆ Found in Text Mining only
Affective Disorders, Psychotic	Affective Psychosis	BEFREE	20031235, 28029428		★☆☆☆☆ Found in Text Mining only
Age-Related Memory Disorders	Age-Related Memory Disorders	CTD_human_DG	18661256, 18686203		★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	18587210		★☆☆☆☆ Found in Text Mining only
Agoraphobia	Agoraphobia	BEFREE	24906789		★☆☆☆☆ Found in Text Mining only
Akinetic-Rigid Variant of Huntington Disease	Akinetic-Rigid Variant Of Huntington Disease	CTD_human_DG	15218539, 15312898, 16137562, 17018277, 17925440, 18831068, 19094060, 19476553, 20929960, 21867705, 28111121		★☆☆☆☆ Found in Text Mining only
Alagille Syndrome	Alagille Syndrome	BEFREE	20002020		★☆☆☆☆ Found in Text Mining only
Alpers Syndrome (disorder)	Alpers Syndrome	BEFREE	31187915		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12003247, 21743130, 32255562, 9848084	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Early Onset	Alzheimer disease	BEFREE	22489754		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	10089018		★☆☆☆☆ Found in Text Mining only
Amnesia Retrograde	Retrograde amnesia	Pubtator	18614671	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	27002149, 31484760, 9267034		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	21562248, 22409360, 25164989, 29187283, 29305855, 30515821, 31223078		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	33242422, 36285345	Associate	★☆☆☆☆ Found in Text Mining only
Androgen Insensitivity Syndrome	Androgen insensitivity syndrome	Pubtator	21423614	Associate	★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	PSYGENET_DG	18690111, 22094432		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anhedonia	Anhedonia	Pubtator	22094432	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anorexia	Anorexia	BEFREE	20209488		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	34856753	Associate	★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	BEFREE	10686552, 12784104, 14987118, 15211642, 15523490, 16397402, 19957188, 22488946, 25785698, 30554102, 31680805, 31804778, 31823595		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia	LHGDN	15211642, 15523490, 16397402		★☆☆☆☆ Found in Text Mining only
Anorexia Nervosa	Anorexia nervosa	Pubtator	25785698, 31823595	Associate	★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial Personality Disorder	BEFREE	10483057, 11449397, 19829167, 20192950, 20363030, 20422643, 20677849, 20947778, 21399568, 22985017		★☆☆☆☆ Found in Text Mining only
Antisocial Personality Disorder	Antisocial personality disorder	Pubtator	18075474, 20405199, 20677849, 20947778, 21399568, 22781862, 26990675	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	10213171, 10395220, 10895569, 11750794, 12083964, 12130784, 12524160, 12556912, 12605066, 12605095, 12876460, 12911615, 14966478, 15048639, 15118354, 15211560, 15302939, 15523490, 15699291, 15852063, 15862212, 16095668, 16288736, 16442081, 16595858, 16943551, 17055531, 17079080, 17151167, 17353910, 17942837, 18004675, 18315446, 18490109, 18614671, 18822694, 18950748, 19154632, 19179283, 19192439, 19199283, 19249159, 19361959, 19426812, 19535614, 19541292, 19723555, 19725030, 19853632, 20010449, 20092830, 20440524, 20502016, 20694965, 20729761, 20863670, 21126730, 21129431, 21196780, 21453464, 21547899, 22124413, 22275169, 22693124, 22921508, 23101739, 23319313, 23445439, 23622853, 23697793, 23714265, 23789884, 23953022, 23986266, 23998497, 24100617, 24152087, 24280015, 24411530, 24438559, 24578078, 24842237, 24874919, 25547397, 25747798, 25833281, 26352193, 26385612, 26467894, 26509115, 26561939, 26860734, 27145764, 27176146, 27257942, 27614969, 28142069, 28272115, 28391138, 28465138, 28491024, 28921740, 29225330, 29348651, 30279456, 30711709, 31045220, 31422473, 9402979, 9672904, 9783565, 9929970		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	11857587, 12911615, 16055563, 17297267, 17299098, 17353910, 17504250, 18075474, 18587210, 18614671, 18925984, 18950748, 19126263, 19154632, 19209222, 19361959, 19535614, 19541292, 19723555, 19864286, 20440524, 20585760, 20694965, 21450307, 21855859, 22032950, 22148994, 22275169, 22390669, 22693124, 22911682, 23112822, 23145795, 23319313, 23341873, 23986266, 23998497, 24152087, 24280015, 24293367, 24411530, 24438559, 24934401, 25314020, 25422957, 25547397, 25675343, 25747798, 25833281, 26111525, 26218602, 26467894, 26509115, 26561939, 26912503, 27176146, 27257942, 27929454, 28391138, 28670115, 28921740, 29348651, 29927798, 30089832, 30711709, 31168173, 31931271, 32157156, 32543106, 33932264, 34199792, 34866045, 35396540, 35604958, 37947344	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	GENOMICS_ENGLAND_DG	15642926, 17101915		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	21547899	Stimulate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	10213171, 10395220, 10895569, 11204346, 11353442, 11750794, 12083964, 12130784, 12524160, 12556912, 12605066, 12605095, 12876460, 12911615, 14966478, 15048639, 15118354, 15211560, 15302939, 15450911, 15523490, 15699291, 15852063, 15862212, 16095668, 16288736, 16442081, 16595858, 16943551, 17055531, 17079080, 17151167, 17353910, 17942837, 18004675, 18266983, 18314311, 18315446, 18490109, 18614671, 18950748, 19154632, 19179283, 19192439, 19199283, 19249159, 19361959, 19426812, 19535614, 19541292, 19723555, 19725030, 19853632, 20010449, 20092830, 20440524, 20502016, 20694965, 20729761, 20863670, 21126730, 21129431, 21196780, 21453464, 21547899, 22124413, 22138391, 22275169, 22693124, 22921508, 23101739, 23319313, 23445439, 23499791, 23510446, 23622853, 23697793, 23714265, 23789884, 23953022, 23986266, 23998497, 24100617, 24152087, 24280015, 24411530, 24438559, 24578078, 24842237, 24874919, 25140050, 25455425, 25547397, 25745133, 25747798, 25833281, 26218602, 26352193, 26385612, 26467894, 26509115, 26561939, 26860734, 27145764, 27176146, 27257942, 27614969, 27739394, 28142069, 28272115, 28391138, 28465138, 28491024, 28629963, 28921740, 28951738, 29225330, 29348651, 30279456, 30711709, 31045220, 31422473, 31727442, 31849623, 9402979, 9672904, 9783565, 9929970		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety disorder	Pubtator	18266983, 19154632, 19541292, 19864286, 21105279, 23772677, 24119861, 25059547, 25140050, 25226553, 25497691, 26218602, 26467894, 27257942, 31727442, 32911381, 33849116	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety Disorders	Anxiety Disorder	CTD_human_DG	18686203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Anxiety States, Neurotic	Anxiety Disorder	CTD_human_DG	18686203		★☆☆☆☆ Found in Text Mining only
Apraxias	Apraxia	Pubtator	33526821, 39242534	Associate	★☆☆☆☆ Found in Text Mining only
As If Personality	As If Personality	CTD_human_DG	17000009		★☆☆☆☆ Found in Text Mining only
Asperger Syndrome	Asperger Syndrome	CTD_human_DG	18197083		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Asthma	Asthma	BEFREE	25640317, 27176146		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ataxia	Ataxia	Pubtator	21183371, 33228685	Associate	★☆☆☆☆ Found in Text Mining only
Ataxia, Spinocerebellar	Spinocerebellar Ataxia	BEFREE	21909428, 22971727, 24972706, 9686302		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	16868569		★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	38447791	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit and Disruptive Behavior Disorders	Attention deficit hyperactivity disorder	Pubtator	18430257, 18614671, 22584505, 24033129, 26990675, 27191831, 30126429	Associate	★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	11923911, 18430257, 19490304, 19858760, 20113357, 20398347, 20677849, 21207241, 21497794, 21778150, 22032950, 23123360, 24797917, 25602736, 26402385, 26746237, 26990675, 27430630, 27738993, 27770470	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	11317229, 11425009, 11684336, 11834311, 12097805, 12232786, 12658617, 12782968, 14574222, 15211560, 15719397, 16082690, 16082698, 16583436, 16679343, 16958038, 17093889, 17948872, 18155777, 18430257, 18452186, 19429092, 19465875, 19858760, 20113357, 20446882, 21200389, 21207241, 21497794, 21610556, 22986128, 23123360, 24116887, 24132904, 24287203, 24929324, 25998280, 26017091, 26184070, 26402385, 26428549, 26746237, 26990675, 27391809, 27430630, 27738993, 28259004, 29256028, 31628528		★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	LHGDN	15719397		★☆☆☆☆ Found in Text Mining only
Auditory Perceptual Disorders	Auditory perceptual disorder	Pubtator	25602736	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	20020537, 21302342, 21538940, 22032950, 23123360, 26262902, 27178863, 28088648, 32899028, 36106519	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	15094787, 16395127, 16698432, 17280648, 19281802, 19360675, 20446882, 20619617, 21254450, 21302342, 21538940, 23123360, 23526151, 24192574, 25261775, 26262902, 26577932, 27091118, 27111230, 27178863, 28088648, 28821725, 30297392, 30394245, 30668912, 31325179		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic behavior	Autism	BEFREE	11443529, 28821725		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	10369890, 10490705, 10673778, 10686565, 10780268, 11071017, 11378854, 11443529, 11803447, 11920155, 12192626, 12232775, 12668354, 14708029, 15108191, 15121991, 15749247, 15882779, 15995945, 16481140, 16616719, 16674932, 16721604, 17151167, 17203304, 17548752, 17999363, 18286633, 18361419, 18593506, 18804097, 18957375, 19360675, 19588468, 20649385, 21118708, 21183371, 21302342, 21538940, 21893166, 25261775, 28406285, 30814960, 31325179, 31618836, 9361027, 9672904		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	LHGDN	11803447, 15995945, 17203304, 18957375		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	15995945, 16103890, 17203304, 17999363, 18361419, 18593506, 19588468, 21183371, 21302342, 26262902, 27140629, 32899028, 36106519	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	16721604, 17203304, 17280648, 20649385, 9152989		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behavior Disorders	Behavior Disorders	BEFREE	30306851		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Behavioral variant of frontotemporal dementia	Behavioral Variant Of Frontotemporal Dementia	BEFREE	26509115		★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	20096463		★☆☆☆☆ Found in Text Mining only
Binge Drinking	Binge drinking	Pubtator	31931271	Associate	★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	BEFREE	10395220, 10490710, 10624553, 10893491, 10898918, 11018311, 11093065, 11386982, 11772685, 12431765, 12746735, 12851635, 15167705, 15802092, 15824745, 15849387, 15986189, 16082508, 16186633, 16300747, 16395126, 16945343, 17579356, 18534687, 18657242, 18792946, 19037205, 19193231, 19224115, 19647327, 20434316, 21040287, 21290142, 22832526, 23277128, 23410635, 23756178, 23931339, 24229495, 24389572, 24411530, 25219494, 25517604, 25704032, 26218602, 26542422, 28667891, 28754344, 30217771, 7711157, 9322234, 9342201, 9514585, 9543202, 9603609, 9611675, 9848084		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	CTD_human_DG	11772685, 16395126		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	LHGDN	15111989, 15824745, 16829782, 17579356		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	15849387, 17283287, 19037205, 19125390, 19224115, 22832526, 23931339, 24229495, 24411530, 25704032, 26218602, 26542422, 33574244, 33828235, 35328036, 38377518, 9848084	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	23931339, 24229495, 25019689, 25194461, 25219494		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar I disorder	Bipolar Disorder	BEFREE	22152117, 25596490, 9514579		★☆☆☆☆ Found in Text Mining only
Bipolar II disorder	Bipolar Disorder	BEFREE	22152117		★☆☆☆☆ Found in Text Mining only
Blood group deletion syndrome	McLeod neuroacanthocytosis syndrome	BEFREE	11761473		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	15167705, 15824745, 16186633, 16690085, 17579356, 18004675, 18756498, 19032968, 19358998, 19699062, 20146650, 30217771, 31595439		★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	Pubtator	17823651, 18075474, 32033618	Associate	★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	22179319, 29272284, 9143014		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26509115, 27870408, 29685790	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	23478049	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	20122741, 20180013, 20944177, 22210241, 23300147, 26293574, 26980106, 29982901		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17989880, 26980106, 27720787, 29090386, 36430579	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	15167705, 15824745, 16186633, 17579356, 30217771, 31595439		★☆☆☆☆ Found in Text Mining only
Bruxism	Bruxism	Pubtator	27329733	Associate	★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	10639135, 18586675, 27984179		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	BEFREE	12478878, 14987118, 16249995, 18306344, 18505306, 19192439, 19493540, 19853632, 20209488, 22018958, 29331600		★☆☆☆☆ Found in Text Mining only
Bulimia	Bulimia	LHGDN	16249995		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	12478878, 15690467, 16407896, 16449418, 17055531, 18505306, 20209488, 22488946, 22815058		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	LHGDN	15940301		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	Pubtator	17511889	Associate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	32432768	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	28054945	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37442189	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	25101683		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	36472833	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic	Hypertrophic cardiomyopathy	Pubtator	36657118	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Restrictive	Restrictive cardiomyopathy	Pubtator	18361419	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	14508013, 17126554, 20509052, 25671637, 27597145		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	18158371		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	20509052, 28267464	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	21315720		★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	22179319, 29272284, 9143014		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral cortical atrophy	Cerebral cortical atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	16525076, 18441666, 19329228, 19411808, 23236014, 23702251, 23973249, 29614501, 30844812		★☆☆☆☆ Found in Text Mining only
Chorea	Chorea	Pubtator	15548484, 33228685, 38447791, 38563088, 8133497	Associate	★☆☆☆☆ Found in Text Mining only
Chorea, Benign Familial	Chorea	BEFREE	8840396		★☆☆☆☆ Found in Text Mining only
Chronic depression	Mental Depression	BEFREE	21165304		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic depression	Mental Depression	PSYGENET_DG	21165304, 22847957, 24323294, 24338983		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	14530202, 16339917, 19556740, 20981038, 24057178, 30219683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	LHGDN	14530202		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Pain	Chronic pain	Pubtator	21423614	Associate	★☆☆☆☆ Found in Text Mining only
clinical depression	Mental Depression	BEFREE	21982504		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	17987668		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	19244517, 22787151, 25568121, 29435951, 29902468, 30850940		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognition disorder	Pubtator	19646924, 20455953, 21908796, 25644221, 26958025, 29435951, 33228685, 39973381	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognition Disorders	Cognitive disorder	CTD_human_DG	23209555		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cognitive Dysfunction	Cognition disorder	Pubtator	40318118	Stimulate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	17170025	Inhibit	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	17170025, 32967429	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22911682, 26327689, 29551185		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22911682	Associate	★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	BEFREE	16732845, 17598758		★☆☆☆☆ Found in Text Mining only
Common Migraine	Common Migraine	LHGDN	16732845		★☆☆☆☆ Found in Text Mining only
Compulsive hoarding	Compulsive Hoarding	HPO_DG			★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct Disorder	LHGDN	16972235		★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct Disorder	BEFREE	18430257, 19465875, 19767592, 26537239, 27350097		★☆☆☆☆ Found in Text Mining only
Conduct Disorder	Conduct disorder	Pubtator	18430257, 20677849, 26990675	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	16380550		★☆☆☆☆ Found in Text Mining only
Congenital Hemidysplasia with Ichthyosiform Erythroderma and Limb Defects	Congenital hemidysplasia with ichthyosiform erythroderma and limb defects	Pubtator	22781862, 25422957	Associate	★☆☆☆☆ Found in Text Mining only
Congenital Hydrocephalus	Congenital Hydrocephalus	BEFREE	18838463		★☆☆☆☆ Found in Text Mining only
Congenital neurologic anomalies	Drachtman Weinblatt Sitarz syndrome	BEFREE	21307087, 21515588		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	17307423		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Constipation	Constipation	Pubtator	15138209, 23393559	Associate	★☆☆☆☆ Found in Text Mining only
Corneal dystrophy Avellino type	Corneal dystrophy	Pubtator	28316463	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	20509052		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	19885623, 20509052		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	25861735	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	20509052	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	10404755, 20509052		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	30394015		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	30394015, 34799637	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	30477895		★☆☆☆☆ Found in Text Mining only
Cystitis Interstitial	Interstitial cystitis	Pubtator	30973927	Associate	★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Delirium	Delirium	Pubtator	11207425	Associate	★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	BEFREE	10490703, 19268543, 19910872, 30733861		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	15000807, 18490109, 19996755, 27283588, 9693390		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	15548484, 17766685, 19996755	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	LHGDN	19020798		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dementia, Vascular	Dementia	BEFREE	20502016		★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	25704032	Associate	★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	10434299, 18651325, 21909428		★☆☆☆☆ Found in Text Mining only
Depression in children	Mental Depression	BEFREE	16458264, 24287203		★☆☆☆☆ Found in Text Mining only
Depression Postpartum	Major depressive disorder	Pubtator	24796636	Associate	★☆☆☆☆ Found in Text Mining only
Depression, Bipolar	Bipolar Disorder	BEFREE	10898918, 11386982		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Bipolar	Bipolar Disorder	PSYGENET_DG	10898918, 11386982		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Bipolar	Bipolar Disorder	CTD_human_DG	11772685, 16395126		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Neurotic	Mental Depression	CTD_human_DG	12898347, 18458677, 18686203, 21843009		★☆☆☆☆ Found in Text Mining only
Depression, Postpartum	Mental Depression	BEFREE	19016475, 20045118, 21576482, 23394411		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depression, Postpartum	Mental Depression	PSYGENET_DG	21997575, 22209125, 23149286, 23394411, 24882202		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	10555044, 11207425, 11505018, 15548484, 16756688, 17283287, 17353910, 17728423, 18005940, 18587210, 18614671, 18801474, 18950748, 18981341, 19005081, 19014073, 19125390, 19128885, 19154632, 19204908, 19288578, 19361959, 19541292, 19573496, 19853044, 19864286, 20336806, 20360314, 20368500, 20455953, 20585760, 20606244, 20664233, 20694965, 21092937, 21423614, 21450307, 21661000, 21743130, 21847802, 21855859, 22032950, 22094432, 22228829, 22390669, 22434222, 22693124, 22832732, 22911682, 23266326, 23319313, 23341873, 23766378, 24119861, 24293367, 24411530, 24796636, 25059547, 25314020, 25422957, 25497691, 25644221, 25655492, 25675343, 25747798, 26228411, 26262902, 26509115, 27176146, 27257942, 27819008, 28391138, 28585930, 28590587, 28638109, 28670115, 28921740, 29090386, 29348651, 29427067, 29982901, 30081968, 30089832, 30948693, 31856211, 32367400, 33764333, 33932264, 33980291, 34199792, 34856753, 34866045, 35604958, 9848084	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	10624553, 10683861, 10960156, 11027924, 11353442, 11543734, 11729031, 11983186, 12145795, 12478878, 12605095, 12759553, 14508013, 14593433, 15211560, 15263905, 15302939, 15312818, 15563601, 15699291, 15867107, 15877306, 15879594, 15880108, 15951088, 16002148, 16005136, 16055263, 16091117, 16095668, 16154545, 16212676, 16288736, 16458264, 16459126, 16476009, 16507957, 16507960, 16541086, 16616982, 16930719, 16934775, 16946185, 16953001, 16965382, 17017823, 17063469, 17094925, 17167343, 17183148, 17216342, 17250473, 17336939, 17353910, 17356577, 17359932, 17408646, 17455215, 17460615, 17481593, 17482146, 17579366, 17617292, 17618721, 17621167, 17659308, 17700575, 17726476, 17728423, 17804080, 17851196, 17882235, 17909168, 17955359, 18005940, 18050262, 18314311, 18315446, 18330458, 18347599, 18349696, 18450378, 18458677, 18490109, 18495314, 18534686, 18614671, 18618621, 18628680, 18640745, 18691701, 18775088, 18801474, 18973248, 18979110, 18981341, 19015103, 19016475, 19040324, 19083208, 19125390, 19128885, 19192439, 19215635, 19249159, 19251870, 19329228, 19332357, 19339052, 19361959, 19410377, 19429111, 19437301, 19438736, 19468717, 19531786, 19541292, 19567894, 19573496, 19586232, 19647944, 19675533, 19683026, 19738481, 19853044, 19858108, 19883751, 19885623, 19899843, 19911410, 20010449, 20024596, 20122741, 20196101, 20231323, 20332289, 20351589, 20368500, 20397838, 20403510, 20455953, 20502016, 20509052, 20577990, 20588071, 20606382, 20637828, 20642399, 20685009, 20694965, 20800901, 20881788, 20944177, 20981038, 21034694, 21037213, 21047622, 21129431, 21199959, 21263010, 21368747, 21394855, 21420735, 21423614, 21439648, 21492940, 21496514, 21547899, 21576482, 21593514, 21604315, 21684723, 21722029, 21764567, 21982504, 21996278, 21997575, 22030619, 22094432, 22095773, 22100130, 22119086, 22134442, 22210241, 22225729, 22236459, 22247094, 22291990, 22328412, 22390669, 22414661, 22418015, 22488946, 22495688, 22520017, 22642841, 22672136, 22693124, 22836288, 22840631, 22847957, 22884012, 22921508, 22951355, 23080078, 23333376, 23481907, 23492930, 23510446, 23547810, 23562852, 23588187, 23643106, 23647137, 23663729, 23672445, 23701535, 23702251, 23766378, 23788696, 23880378, 23893825, 23973249, 23973251, 24035489, 24077031, 24098925, 24219410, 24287203, 24338983, 24374553, 24411530, 24433089, 24443391, 24462335, 24679392, 24779425, 24862560, 24866526, 24937096, 24972569, 24996193, 25078292, 25173097, 25214390, 25226554, 25347540, 25422957, 25422958, 25640317, 25650523, 25688466, 25711941, 25745133, 25747798, 25760924, 25772786, 25989139, 25990886, 26016887, 26055783, 26070769, 26093833, 26228411, 26232751, 26262902, 26315979, 26327689, 26330209, 26509115, 26609890, 26674707, 26909988, 26938215, 26976307, 27005686, 27138797, 27176146, 27277475, 27416920, 27427178, 27515846, 27525827, 27565518, 27701012, 27788383, 27819008, 27826101, 27880876, 27998510, 28024274, 28142069, 28195567, 28272863, 28325682, 28373689, 28391138, 28416295, 28444137, 28499269, 28533695, 28569537, 28585930, 28629963, 28638109, 28645747, 28652746, 28756191, 28774788, 28892067, 28901577, 28921740, 28935838, 29031184, 29069597, 29094757, 29129791, 29225330, 29331709, 29451287, 29535036, 29547643, 29683385, 29913130, 29930222, 29982901, 30127611, 30147642, 30176268, 30180828, 30279456, 30306851, 30447571, 30529315, 30718449, 30948693, 31024427, 31181376, 31319341, 31629822, 31784962, 31849623, 9175133, 9514579, 9577843, 9672904, 9857976		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	CTD_human_DG	12898347, 18458677, 18686203, 21843009		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	PSYGENET_DG	15548484, 23588187, 23678106, 23697793, 24972302, 25422957, 25510949, 25583186		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	LHGDN	16829782, 17621167		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	21547899, 24620999	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	17987668, 18075474, 18801474, 18950748, 19125390, 19288578, 19361959, 20360314, 24341893, 24620999, 26561939, 27622490, 28638109, 29703883, 32879073, 32911381, 33764333	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Syndrome	Mental Depression	CTD_human_DG	12898347, 18458677, 18686203, 21843009		★☆☆☆☆ Found in Text Mining only
Depressive Syndrome	Mental Depression	BEFREE	19251870		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic	Atopic dermatitis	Pubtator	26831833	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	LHGDN	18181968		★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	22124413, 23947391		★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	27329733, 31371571, 33432339	Associate	★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	22921508, 25640317		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	25512553, 26921319, 28650965	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17355243	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22311265, 22921508, 25640317		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19891962, 25680681, 25927430		★☆☆☆☆ Found in Text Mining only
Diarrhea	Diarrhea	Pubtator	15361494, 22457857, 23393559, 32439979	Associate	★☆☆☆☆ Found in Text Mining only
Diastrophic dysplasia	Diastrophic dysplasia	Pubtator	20526950	Associate	★☆☆☆☆ Found in Text Mining only
Disruptive Impulse Control and Conduct Disorders	Disruptive, impulse control, and conduct disorders	Pubtator	19493540, 20677849, 21497794, 23123360, 24280015, 28295205, 28391138, 29090386, 31856211, 35328036	Associate	★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	BEFREE	18491196		★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	LHGDN	18491196		★☆☆☆☆ Found in Text Mining only
Diverticulitis	Diverticulitis	Pubtator	18491196	Inhibit	★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	18270821		★☆☆☆☆ Found in Text Mining only
Dysautonomia, Familial	Dysautonomia	BEFREE	25148529, 28291238		★☆☆☆☆ Found in Text Mining only
Dysbiosis	Dysbiosis	Pubtator	36291689	Associate	★☆☆☆☆ Found in Text Mining only
Dysentery	Dysentery	Pubtator	21273531	Associate	★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	BEFREE	21909362		★☆☆☆☆ Found in Text Mining only
Dysphoric mood	Mood Disorder	BEFREE	17079080, 20462563, 22309725, 28652746		★☆☆☆☆ Found in Text Mining only
Dysphoric mood	Mood Disorder	PSYGENET_DG	17079080, 20462563, 22309725		★☆☆☆☆ Found in Text Mining only
Dysthymic Disorder	Dysthymic Disorder	BEFREE	15312818		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysthymic Disorder	Dysthymic Disorder	PSYGENET_DG	15312818		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dysthymic Disorder	Dysthymic disorder	Pubtator	18826446	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dystonia	Dystonia	Pubtator	27329733	Associate	★☆☆☆☆ Found in Text Mining only
Eating Disorders	Eating Disorders	BEFREE	10686552, 14625025, 15211642, 16969275, 17055531, 18306344, 19708070, 19853632, 20209488, 22815058, 26895183, 27701012, 31804778, 31823595		★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	22124413, 23947391		★☆☆☆☆ Found in Text Mining only
Edema	Edema	Pubtator	28972180	Associate	★☆☆☆☆ Found in Text Mining only
Endogenous depression	Mental Depression	CTD_human_DG	12898347, 18458677, 18686203, 21843009		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	15299092		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	24093801, 25173097, 25481722		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	27329733	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Frontal Lobe	Frontal lobe epilepsy	Pubtator	19037205	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	17548158, 20435093, 20655708, 21498047, 21951270, 22222329, 23065262, 23516322		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	LHGDN	17548158		★☆☆☆☆ Found in Text Mining only
Etat Marbre	Status marmoratus	CTD_human_DG	20929960		★☆☆☆☆ Found in Text Mining only
Familial Primary Pulmonary Hypertension	Pulmonary hypertension	Pubtator	16339917	Associate	★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	26473596	Associate	★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	17340199, 30742117		★☆☆☆☆ Found in Text Mining only
Frontotemporal dementia	Frontotemporal dementia	BEFREE	25128279, 31810584		★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	26509115, 33242422, 36285345	Associate	★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	19020798, 30583877		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal disease	Pubtator	15138209, 21273531, 27493135	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Diseases	Gastrointestinal Diseases	BEFREE	21447358		★☆☆☆☆ Found in Text Mining only
Gilles de la Tourette syndrome	Tourette Syndrome	BEFREE	11166081, 20010450, 20739786, 23630162		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25050814	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	BEFREE	9702741		★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	30394015		★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	BEFREE	28295205		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	18957375, 19179283, 21893166, 27933583, 28109119, 28198447, 30373627, 30817127		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	21604315		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	BEFREE	10381332		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart disease	Pubtator	17283287, 20585760, 30028085	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart failure	Heart Failure	BEFREE	17307423		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Septal Defects Ventricular	Congenital heart septal defect	Pubtator	19886858	Associate	★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	BEFREE	16380550		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic neoplasm	Pubtator	9616134	Associate	★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	9616134		★☆☆☆☆ Found in Text Mining only
Heredodegenerative Disorders, Nervous System	Heredodegenerative Disorders, Nervous System	BEFREE	19278999, 27553284, 30455632		★☆☆☆☆ Found in Text Mining only
High altitude pulmonary edema	High Altitude Pulmonary Edema	BEFREE	27196063		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	29427099, 7581375		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	10023115, 10078572, 10090478, 10196373, 10354600, 10369868, 10434298, 10434302, 10434304, 10434306, 10441327, 10441347, 10478585, 10482267, 10502825, 10515664, 10527804, 10639135, 10716661, 10733228, 10766906, 10770860, 10794362, 10814708, 10823891, 10958656, 10966117, 10970063, 10980573, 11013077, 11035034, 11040449, 11092755, 11092756, 11092762, 11128600, 11182459, 11245667, 11331615, 11406606, 11408619, 11432963, 11442349, 11466559, 11593450, 11604514, 11642542, 11738470, 11765125, 11792857, 11792860, 11821898, 11839795, 11854752, 11870213, 11906690, 11906693, 11914418, 11943195, 11978824, 11988536, 12008025, 12062094, 12089530, 12117755, 12165554, 12165556, 12217951, 12223539, 12354289, 12354780, 12393793, 12405543, 12490527, 12554681, 12559971, 12604778, 12657886, 12706247, 12711212, 12718899, 12747895, 12783847, 12805114, 12821179, 12869810, 12881722, 12969257, 12969272, 14506070, 14526190, 14557053, 14557250, 14709789, 14713958, 14725621, 14751289, 14978262, 14978683, 14985437, 14999077, 15036808, 15040808, 15048901, 15064418, 15081595, 15147313, 15163634, 15190011, 15193429, 15240759, 15349858, 15352068, 15354395, 15371500, 15447674, 15456523, 15459747, 15483602, 15525658, 15548484, 15548647, 15590702, 15598740, 15606779, 15610167, 15629196, 15644269, 15689354, 15695335, 15704211, 15715085, 15720212, 15737634, 15742215, 15811941, 15836623, 15837560, 15890517, 15911879, 15916486, 15934871, 15967379, 15968004, 15968465, 15990326, 16006135, 16019264, 16043692, 16087879, 16095740, 16103364, 16115812, 16135087, 16165367, 16202123, 16204350, 16251441, 16262645, 16274727, 16278236, 16278683, 16288298, 16289252, 16300642, 16365166, 16369839, 16380118, 16391387, 16403806, 16405500, 16405510, 16416264, 16442295, 16452687, 16473015, 16492755, 16522639, 16525063, 16537516, 16699519, 16729030, 16751280, 16777606, 16787406, 16820007, 16829072, 16847693, 16893904, 16925587, 16968735, 16973207, 17007735, 17012230, 17014717, 17018277, 17041811, 17092742, 17108691, 17115386, 17124493, 17126554, 17182613, 17213233, 17240289, 17240517, 17276692, 17299753, 17316906, 17327878, 17327906, 17335925, 17352936, 17396163, 17403029, 17413322, 17455294, 17472569, 17478887, 17493035, 17500595, 17503740, 17512917, 17519223, 17557337, 17596446, 17604996, 17611284, 17653262, 17877635, 17902043, 17941857, 17952586, 17961788, 17975550, 17984172, 17986868, 18006350, 18068007, 18073586, 18076027, 18078716, 18156153, 18184562, 18192679, 18293418, 18337408, 18367595, 18386172, 18388917, 18403567, 18417352, 18466116, 18488016, 18502655, 18504298, 18549309, 18558632, 18586675, 18588526, 18595722, 18602275, 18606820, 18625748, 18632688, 18636076, 18637945, 18637946, 18640989, 18651325, 18658163, 18718937, 18768695, 18772195, 18815258, 18838463, 18923047, 18981372, 18986984, 18992820, 19018245, 19022249, 19023407, 19036965, 19039036, 19059613, 19118166, 19193873, 19193881, 19196932, 19204007, 19240687, 19266143, 19268537, 19270310, 19278999, 19279257, 19289118, 19334076, 19362590, 19386911, 19394359, 19394403, 19412185, 19429504, 19443488, 19458943, 19460884, 19464273, 19515365, 19521824, 19530012, 19548952, 19551467, 19566678, 19602103, 19607813, 19608102, 19621255, 19646924, 19664996, 19667213, 19686238, 19710014, 19796074, 19845749, 19857538, 19908918, 19933700, 20018729, 20056037, 20058166, 20082975, 20107928, 20140187, 20145031, 20145253, 20152113, 20154343, 20190739, 20236390, 20237277, 20298220, 20332821, 20354076, 20357106, 20360314, 20383138, 20403078, 20406248, 20416508, 20421366, 20444706, 20494921, 20497470, 20515468, 20519964, 20531388, 20547568, 20552561, 20556492, 20558522, 20566711, 20629137, 20649476, 20664076, 20668093, 20670829, 20687494, 20697744, 20710011, 20736066, 20802793, 20887786, 20923757, 20923788, 20936902, 21028906, 21044956, 21048129, 21056115, 21068307, 21069748, 21095568, 21095569, 21117121, 21130037, 21153060, 21177255, 21192926, 21199443, 21245084, 21248742, 21257639, 21285520, 21307087, 21315254, 21322024, 21336284, 21355047, 21403395, 21432905, 21440048, 21441583, 21447599, 21454471, 21454633, 21465263, 21489966, 21496570, 21496572, 21509658, 21513696, 21515588, 21518730, 21519949, 21554955, 21562226, 21672921, 21685499, 21713039, 21757738, 21768291, 21854837, 21875723, 21887328, 21889981, 21896647, 21897851, 21904093, 21907094, 21907096, 21909362, 21909428, 21910887, 21971427, 21985782, 21985783, 21988129, 21997870, 22008211, 22010050, 22031240, 22045698, 22052350, 22080977, 22095086, 22103299, 22110140, 22116937, 22119730, 22120646, 22122824, 22137354, 22150069, 22155432, 22158031, 22179319, 22187438, 22198502, 22198539, 22219281, 22240898, 22252996, 22306231, 22337954, 22375012, 22383888, 22387017, 22399227, 22409360, 22422149, 22426400, 22441874, 22450871, 22473822, 22482451, 22492998, 22511757, 22543707, 22556411, 22580459, 22589249, 22627493, 22649491, 22678061, 22694310, 22698685, 22700462, 22741533, 22748967, 22773688, 22787151, 22794259, 22815947, 22875942, 22891683, 22892315, 22906125, 22939619, 22971727, 22974690, 22974734, 22982606, 22984513, 22990145, 22996692, 23001568, 23008174, 23029535, 23054839, 23115180, 23116281, 23131566, 23145961, 23160193, 23190281, 23197653, 23220414, 23223017, 23236391, 23300147, 23324594, 23341618, 23341638, 23347954, 23349722, 23372043, 23373812, 23398026, 23414820, 23416527, 23423362, 23446639, 23455440, 23463025, 23469253, 23525043, 23549885, 23557875, 23560309, 23583659, 23595883, 23598407, 23641925, 23656494, 23664844, 23697793, 23719918, 23720495, 23741403, 23747361, 23762270, 23781027, 23800350, 23810380, 23829302, 23830927, 23853009, 23861941, 23871671, 23874679, 23887934, 23894380, 23898200, 23906595, 23957861, 23965969, 23980182, 24012756, 24022020, 24038471, 24081492, 24102565, 24105466, 24121255, 24184605, 24199621, 24248062, 24248470, 24256709, 24274906, 24277524, 24285878, 24330821, 24347322, 24367279, 24376631, 24380395, 24381308, 24390280, 24405192, 24407293, 24459107, 24471773, 24471944, 24475300, 24484067, 24505464, 24511594, 24525128, 24573776, 24581271, 24584051, 24588402, 24631682, 24646433, 24686787, 24694346, 24705354, 24751919, 24784230, 24798518, 24816393, 24836077, 24916565, 24921664, 24926995, 24929669, 24938402, 24951540, 24960609, 25034271, 25035419, 25038828, 25092288, 25101683, 25124273, 25155258, 25160573, 25164989, 25178567, 25205109, 25205111, 25207939, 25271153, 25271967, 25305076, 25307798, 25311206, 25316320, 25351248, 25368120, 25398943, 25398949, 25416977, 25452431, 25464275, 25466405, 25535386, 25556834, 25568121, 25640796, 25645993, 25656686, 25689972, 25699594, 25703232, 25719447, 25736541, 25760041, 25773959, 25844897, 25847392, 25848931, 25849918, 25866135, 25871323, 25876513, 25927346, 25928884, 25931812, 25938884, 25941073, 25953777, 26001312, 26010866, 26025364, 26079385, 26092128, 26100538, 26148071, 26165689, 26174131, 26198591, 26201449, 26218986, 26232222, 26241927, 26254860, 26264576, 26293574, 26295712, 26307259, 26307536, 26310631, 26320893, 26358776, 26371883, 26428226, 26428929, 26461267, 26466780, 26496077, 26522374, 26529236, 26586297, 26590344, 26636336, 26636579, 26642438, 26660732, 26661162, 26691352, 26711622, 26826449, 26849111, 26850319, 26876526, 26908605, 26908611, 26938440, 26944172, 26951563, 26959244, 26969684, 26980106, 27002149, 27008868, 27017930, 27033979, 27063456, 27098187, 27107943, 27126634, 27140644, 27146268, 27170315, 27182645, 27188817, 27196502, 27203582, 27206983, 27207688, 27221610, 27257945, 27335079, 27377031, 27378694, 27378699, 27400454, 27405468, 27466181, 27477323, 27479945, 27483361, 27506601, 27525439, 27529325, 27529534, 27538642, 27553284, 27615381, 27638306, 27713486, 27721240, 27721444, 27740685, 27749395, 27815841, 27823570, 27840125, 27840155, 27856625, 27857176, 27868347, 27913212, 27913616, 27924526, 27934595, 27940602, 27957684, 27979358, 27984179, 28000697, 28007908, 28017473, 28017939, 28027448, 28069792, 28094373, 28096245, 28102321, 28104789, 28111121, 28129107, 28153533, 28165127, 28172889, 28175299, 28182673, 28194040, 28194132, 28213125, 28235896, 28238795, 28259758, 28263187, 28265888, 28270748, 28282438, 28288000, 28303108, 28322270, 28359739, 28368337, 28369732, 28384479, 28387881, 28391013, 28391067, 28398721, 28400517, 28406522, 28406616, 28412438, 28436437, 28445460, 28465506, 28494017, 28497201, 28499347, 28508341, 28523552, 28524599, 28533744, 28537272, 28550168, 28570578, 28578004, 28590448, 28593442, 28603746, 28609090, 28611571, 28621522, 28632387, 28632780, 28633139, 28653853, 28656686, 28662109, 28674491, 28698602, 28701700, 28715425, 28743452, 28771234, 28786671, 28789621, 28792249, 28817209, 28821645, 28832564, 28848389, 28858902, 28861715, 28864412, 28871787, 28900136, 28920551, 28930690, 28934397, 28937758, 28938121, 28939435, 28947110, 28947113, 28947123, 28947125, 28947126, 28954224, 28972180, 28973132, 28975278, 28976800, 28977442, 28983241, 28986324, 29056363, 29079832, 29093475, 29130397, 29134321, 29134957, 29151587, 29160844, 29162692, 29166617, 29171910, 29172480, 29178352, 29203806, 29207890, 29209494, 29212711, 29212816, 29225330, 29232946, 29234268, 29259100, 29259176, 29264979, 29272284, 29281014, 29282287, 29294248, 29302199, 29305855, 29308690, 29311338, 29324753, 29328442, 29342448, 29346421, 29355642, 29358329, 29378824, 29382760, 29399649, 29413175, 29422836, 29427099, 29430620, 29433686, 29435951, 29440125, 29451775, 29462355, 29491012, 29499308, 29500937, 29503201, 29506378, 29509900, 29510748, 29526547, 29535594, 29553509, 29578503, 29581260, 29582587, 29606351, 29608652, 29619771, 29620999, 29627459, 29630769, 29643462, 29671352, 29682858, 29684586, 29685790, 29694882, 29709465, 29713895, 29743513, 29743609, 29789657, 29791508, 29802276, 29804730, 29856014, 29856017, 29856019, 29856021, 29856024, 29856025, 29856032, 29856033, 29858077, 29858092, 29860423, 29870995, 29875678, 29883458, 29891550, 29894684, 29902468, 29904030, 29914757, 29932473, 29934597, 29945611, 29946240, 29956026, 29959348, 29973113, 29979597, 29984244, 29987005, 30002810, 30007561, 30010666, 30015953, 30022873, 30028085, 30038412, 30067285, 30089251, 30107216, 30120672, 30143534, 30149534, 30149694, 30150378, 30156416, 30171891, 30176350, 30182387, 30185623, 30186318, 30194046, 30195782, 30209243, 30252478, 30254002, 30256717, 30279700, 30282695, 30283298, 30290707, 30291526, 30292559, 30312396, 30315108, 30321100, 30332437, 30339373, 30355486, 30358836, 30367943, 30391555, 30399392, 30409256, 30423259, 30450032, 30451892, 30452683, 30455632, 30486313, 30502498, 30509361, 30515821, 30528913, 30538129, 30540190, 30550751, 30573872, 30582582, 30583877, 30585395, 30587076, 30600476, 30616867, 30618600, 30624705, 30626701, 30632085, 30658253, 30672003, 30685323, 30711541, 30726572, 30766446, 30768638, 30788585, 30802639, 30842263, 30844400, 30850940, 30858393, 30897183, 30902619, 30913220, 30916978, 30941013, 30941017, 30947515, 30961637, 30984798, 30994454, 31004885, 31015293, 31040226, 31042572, 31049134, 31059641, 31076452, 31076648, 31079989, 31088970, 31095731, 31103960, 31104296, 31104771, 31108174, 31109380, 31110208, 31138642, 31166067, 31167196, 31184975, 31187915, 31223078, 31259362, 31263285, 31278192, 31282030, 31286142, 31296921, 31297710, 31300691, 31302194, 31313908, 31316341, 31326748, 31353319, 31361762, 31371571, 31375812, 31379510, 31398342, 31418858, 31432317, 31435904, 31444920, 31445164, 31447328, 31450785, 31460743, 31465962, 31466833, 31479233, 31484760, 31491822, 31529216, 31572186, 31586354, 31595198, 31595905, 31599037, 31600787, 31614197, 31648394, 31666200, 31677786, 31690177, 31692944, 31693428, 31695068, 31695145, 31704691, 31708117, 31712634, 31715317, 31722751, 31725947, 31727211, 31737741, 31742766, 31744868, 31745548, 31767406, 31778667, 31786267, 31790427, 31796991, 31813995, 31814404, 31820322, 31822756, 31828084, 31834602, 7477378, 7484060, 7576661, 7581375, 7618107, 7639626, 7668287, 7711729, 7748554, 7751845, 7820679, 7847863, 7853373, 7868117, 7909529, 7959767, 7981682, 8044653, 8105214, 8111375, 8133511, 8162020, 8178825, 8208412, 8242074, 8268907, 8366869, 8458085, 8521295, 8528671, 8544189, 8595423, 8614526, 8634693, 8643490, 8643525, 8659522, 8678115, 8735227, 8757264, 8766138, 8840396, 8855141, 8858182, 8866494, 8867730, 8875248, 8937828, 8954302, 8980018, 9108071, 9143014, 9153618, 9184242, 9217979, 9251070, 9285789, 9299885, 9302293, 9382472, 9388503, 9392570, 9398841, 9427501, 9491297, 9536080, 9536081, 9536082, 9599014, 9616134, 9647305, 9660943, 9666478, 9668110, 9686302, 9700187, 9700202, 9714810, 9725082, 9768849, 9809064, 9819135, 9852681, 9887328, 9894873, 9949199, 9989457		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	10217265, 10434302, 10471702, 10537061, 10766906, 10770860, 11007801, 11106399, 11137014, 11245667, 11593450, 11792860, 11943195, 12091468, 12191472, 12200548, 12438470, 14506070, 14527999, 14617779, 14985437, 15040808, 15548484, 15832309, 16043692, 16202123, 16372906, 16492755, 16973623, 17276991, 17327906, 17403029, 17653262, 17687393, 17877635, 17952586, 17989880, 18073586, 18156153, 18386172, 18498421, 18855765, 19094060, 19118166, 19196932, 19249009, 19338577, 19361997, 19515365, 19621255, 19646924, 19710014, 19752198, 19796074, 20360314, 20710011, 20923788, 21028906, 21095568, 21247881, 21248742, 21257639, 21566141, 21585328, 21672921, 21755114, 21811303, 21887328, 21909428, 22008211, 22100810, 22110140, 22198539, 22235343, 22237433, 22359536, 22383888, 22387017, 22649062, 22741533, 22748967, 22773688, 22801429, 22891249, 22974690, 22990145, 22993450, 22996692, 23236391, 23319588, 23463025, 23481379, 23557875, 23595883, 23624566, 23644918, 23656494, 23720755, 23741403, 23853009, 23873212, 23887934, 23894380, 23965969, 23966247, 24038471, 24199621, 24274906, 24282292, 24314096, 24459107, 24459296, 24751919, 24921664, 25092318, 25275533, 25294428, 25330023, 25466405, 25505179, 25640796, 25656686, 25659157, 25726852, 25847392, 25928884, 25953777, 25992839, 25993131, 25995452, 26011179, 26079385, 26148071, 26198591, 26201449, 26218986, 26232222, 26320893, 26444025, 26496077, 26590344, 26636336, 26636579, 26652744, 26849111, 26850319, 26958025, 26980106, 27080129, 27098187, 27114501, 27170315, 27182645, 27288730, 27329733, 27346008, 27346013, 27346026, 27477323, 27479945, 27481337, 27678206, 27740685, 27840125, 27870408, 28000697, 28165127, 28172889, 28205498, 28238795, 28322270, 28400517, 28436437, 28508341, 28570578, 28601473, 28621522, 28632780, 28656686, 28701700, 28832564, 28937758, 28972180, 28973411, 28975278, 29125493, 29258536, 29264979, 29272284, 29282287, 29328442, 29342448, 29358329, 29403030, 29435951, 29627459, 29682858, 29684586, 29685790, 29743609, 29754822, 29791508, 29802276, 29804730, 29932473, 30010666, 30015953, 30028085, 30122542, 30149534, 30256717, 30332437, 30355486, 30538129, 30573872, 30658253, 30768638, 30811996, 30858393, 30863908, 31104771, 31110208, 31296921, 31326748, 31346086, 31358058, 31361762, 31371571, 31398342, 31491822, 31708117, 31712634, 31717806, 31814404, 31828084, 32067426, 32070434, 32087949, 32124191, 32127471, 32179492, 32182692, 32329133, 32424160, 32555394, 32592593, 32661355, 32668197, 32686867, 32696070, 32741964, 32761094, 32898862, 33049985, 33070471, 33096080, 33219289, 33228685, 33328328, 33432339, 33517535, 33606279, 33692166, 33789134, 33814456, 33874957, 33909994, 34073127, 34089719, 34180418, 34201610, 34239038, 34301881, 34445125, 34448021, 34473992, 34520257, 34536046, 34732320, 34850120, 34880419, 34936701, 34942093, 35082301, 35325614, 35379994, 35395816, 35604958, 35703323, 35759798, 35872525, 35946926, 35948542, 36040815, 36180805, 36262216, 36285345, 36293267, 36357392, 36434993, 36437609, 36585400, 36651994, 36658243, 36715614, 36863131, 36901739, 36902304, 36931390, 36971475, 37005488, 37062072, 37146135, 37501188, 37522694, 37651831, 37761821, 37761940, 37993517, 38003344, 38016971, 38141760, 38427495, 38447791, 38498709, 38563088, 38569398, 39174070, 39174523, 39284371, 39367331, 39923663, 40090627, 40258535, 40289673, 40336225, 7576661, 7668287, 7853373, 8133497, 8178825, 8521295, 8544189, 8659522, 8971113, 9108071, 9153618, 9489526, 9616134, 9647305, 9666478, 9792871	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	LHGDN	11432963, 12657678, 12682342, 12952868, 14978262, 15261377, 15359012, 15496672, 15843398, 16115812, 16204350, 16729030, 17115386, 17240517, 17902043, 17952586, 18157708, 18400894, 18558632, 18981372, 19018245		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	CTD_human_DG	15218539, 15312898, 16137562, 17018277, 17925440, 18831068, 19094060, 19476553, 20929960, 21867705, 28111121		★☆☆☆☆ Found in Text Mining only
Huntington disease	Huntington Disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	ORPHANET_DG	21566141		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	GWASDB_DG	22387017		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	24587280	Stimulate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	9660943	Inhibit	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Huntington Disease, Late Onset	Huntington Disease	CTD_human_DG	15218539, 15312898, 16137562, 17018277, 17925440, 18831068, 19094060, 19476553, 20929960, 21867705, 28111121		★☆☆☆☆ Found in Text Mining only
HUNTINGTON DISEASE-LIKE 2	Huntington Disease-Like	BEFREE	27288455		★☆☆☆☆ Found in Text Mining only
Huntington Disease-Like Syndrome	Huntington Disease-Like	BEFREE	27400454		★☆☆☆☆ Found in Text Mining only
Hyalinosis, Systemic	Hyalinosis	BEFREE	23123704		★☆☆☆☆ Found in Text Mining only
Hyperkinesis	Hyperkinesia	Pubtator	23123360, 24797917, 32157156	Associate	★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	21497794	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	17506858	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	21206007, 28267464	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	11602621, 15059929, 16339917, 19556740	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	16002749	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	16339917, 28272473		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	16399993, 17702053		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	20594303		★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Ichthyosis Bullosa Of Siemens	BEFREE	15361494, 17564628		★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Junctional epidermolysis bullosa	Pubtator	19125330	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	11602621, 12503718, 16009349, 16614302, 19886858, 20395645, 21464983, 22177971, 24075737, 28529483, 28576407		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	11602621, 12503718, 16009349, 16339917, 16614302, 19844076, 24075737		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune System Diseases	BEFREE	12590173, 24459107		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	16941121, 18490109, 19244517, 20502016, 21177255, 21908796, 22787151, 24405192, 25160573, 25568121, 25871323, 25882604, 26025364, 26428929, 29325450, 29435951, 29902468, 30282695, 30409256, 30837611, 30850940		★☆☆☆☆ Found in Text Mining only
Impulse-Ridden Personality	Impulse-Ridden Personality	CTD_human_DG	17000009		★☆☆☆☆ Found in Text Mining only
Inadequate Personality	Inadequate Personality	CTD_human_DG	17000009		★☆☆☆☆ Found in Text Mining only
Infantile Spasm	Infantile Spasms	BEFREE	23775678		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	17241856		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	19487253	Stimulate	★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	21128207		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	25512553	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	20175892, 24411530	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	20735998		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	27329733		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	19587001, 21273531	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal Diseases	BEFREE	28824378		★☆☆☆☆ Found in Text Mining only
Involutional Depression	Involutional Depression	CTD_human_DG	16055263		★☆☆☆☆ Found in Text Mining only
Involutional paraphrenia	Involutional Paraphrenia	CTD_human_DG	16055263		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30002810		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	12135035, 15138209, 15361494, 17040410, 17241856, 17564628, 17909168, 18511740, 18550438, 19125330, 19309415, 19426812, 19561511, 19655247, 19687750, 21443700, 22014438, 22403795, 22435794, 22457857, 22855291, 24069428, 24392134, 24512255, 26744473, 26912503, 27688655, 28160607, 28951738, 30309244		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	LHGDN	15188158, 17909168		★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	15361494, 17170025, 18511740, 19125330, 19309415, 22014438, 22457857, 22855291, 23393559, 24392134, 26912503, 28458330, 34165249	Associate	★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	20303355, 22323131, 26744473	Inhibit	★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	16582043		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30844812		★☆☆☆☆ Found in Text Mining only
Jaw Abnormalities	Jaw Abnormalities	BEFREE	19193881		★☆☆☆☆ Found in Text Mining only
Juvenile Huntington Disease	Huntington Disease	CTD_human_DG	15218539, 15312898, 16137562, 17018277, 17925440, 18831068, 19094060, 19476553, 20929960, 21867705, 28111121		★☆☆☆☆ Found in Text Mining only
Juvenile Huntington Disease	Huntington Disease	ORPHANET_DG	17181545		★☆☆☆☆ Found in Text Mining only
Juvenile Huntington disease	Huntington Disease	Orphanet			★☆☆☆☆ Found in Text Mining only
Juvenile Huntington Disease	Huntington Disease	BEFREE	17687393, 21412977, 31717806		★☆☆☆☆ Found in Text Mining only
Juvenile Myoclonic Epilepsy	Myoclonic Epilepsy	BEFREE	25481722		★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning Disorders	BEFREE	15666036		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	20594303		★☆☆☆☆ Found in Text Mining only
Leigh Disease	Leigh syndrome	Pubtator	17702275	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	11739372		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelomonocytic, Chronic	Myelomonocytic Leukemia	BEFREE	9616134		★☆☆☆☆ Found in Text Mining only
Leukodystrophy, Metachromatic	Metachromatic Leukodystrophy	LHGDN	18831910		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	30884365		★☆☆☆☆ Found in Text Mining only
Linear atrophy	Atrophy	BEFREE	31133811		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26024595		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	26024595		★☆☆☆☆ Found in Text Mining only
LOPES-MACIEL-RODAN SYNDROME	Lopes-Maciel-Rodan Syndrome	UNIPROT_DG	26740508, 27329733		★☆☆☆☆ Found in Text Mining only
LOPES-MACIEL-RODAN SYNDROME	Lopes-Maciel-Rodan Syndrome	GENOMICS_ENGLAND_DG	27329733		★☆☆☆☆ Found in Text Mining only
LOPES-MACIEL-RODAN SYNDROME	Lopes-Maciel-Rodan Syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Lung diseases	Lung Diseases	BEFREE	16009349		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32432768	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	27819008, 38297395	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	23893825, 27819008		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	16973207, 19412185, 23887934, 24972706, 26141599, 28445460		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 1	Major Affective Disorder	BEFREE	12431765, 12746735, 15167705, 9514585, 9543202		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	10624553, 12431765, 12746735, 15167705, 7711157, 9514585, 9543202, 9611675		★☆☆☆☆ Found in Text Mining only
Major Affective Disorder 2	Major depressive disorder	Pubtator	15849387, 17360901	Associate	★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 4	Major Affective Disorder	BEFREE	12431765, 12746735, 15167705, 9514585, 9543202		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 6	Major Affective Disorder	BEFREE	12431765, 12746735, 15167705, 9514585, 9543202		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 7	Major Affective Disorder	BEFREE	12746735, 15167705, 9514585, 9543202		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 8	Major Affective Disorder	BEFREE	12746735, 15167705, 9514585, 9543202		★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 9	Major Affective Disorder	BEFREE	12746735, 15167705, 9514585, 9543202		★☆☆☆☆ Found in Text Mining only
Major depression, single episode	Mental Depression	BEFREE	11840315, 18050262, 19288578, 20045118, 22119086, 23973251, 24620999, 25257397, 25592385, 25704032, 29287766		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	BEFREE	10359482, 10780268, 10920459, 11311507, 11817517, 11983186, 12378120, 12476327, 12849930, 12851635, 14506400, 15167699, 15312818, 15592465, 15691525, 15842033, 15867106, 15877307, 15879594, 15993855, 16023085, 16055263, 16154545, 16300747, 16319503, 16390888, 16525076, 16616982, 16804504, 16930719, 16946185, 17123473, 17284168, 17299512, 17406646, 17453062, 17544379, 17618721, 17635185, 17853254, 17886257, 17974934, 17987668, 18180427, 18286634, 18378990, 18644006, 18718871, 18801474, 18848359, 18950748, 19008895, 19125107, 19125390, 19272758, 19288578, 19358877, 19387615, 19434367, 19475634, 19531786, 19560507, 20010449, 20016401, 20029939, 20045118, 20047709, 20090673, 20147891, 20360314, 20360351, 20397838, 20450949, 20459391, 20584552, 20588071, 20640435, 20800901, 20934189, 20962544, 21492940, 21595526, 21911028, 22086748, 22247094, 22291990, 22921522, 23017007, 23021380, 23095326, 23149035, 23290204, 23394411, 23562852, 23618376, 23813968, 24014145, 24278217, 24341893, 24657235, 24679990, 24858363, 24882202, 24911443, 24972302, 25226554, 25510949, 25650523, 25739526, 25779937, 25825812, 25827644, 25990886, 26261165, 26561939, 26879101, 26974654, 26979101, 27005686, 27023264, 27212180, 27261564, 27277475, 27505229, 27668354, 27888722, 27964944, 28638109, 28811068, 28935838, 29114103, 29300091, 29358097, 29414128, 29778546, 29957477, 30226714, 30447571, 30565905, 30581206, 30724325, 31228794, 31319341, 31353282, 31583809, 31629822, 31721892, 31792367, 9514579, 9799087		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	CTD_human_DG	16055263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	24679990, 24972302, 25226554, 25510949, 25650523		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	GWASCAT_DG	30718901		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Carcinoid Syndrome	Carcinoid tumor of intestine	BEFREE	29210063		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	21604315		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	20122741, 20180013, 20944177, 22210241, 23300147, 26293574, 26980106, 29982901		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18822694, 19856660, 20944177, 24553116, 26024595, 26327689, 26980106, 29440125, 29551185		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	11092755, 19933700, 31680805		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23300147, 26293574, 26980106		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	BEFREE	11386982, 16395126, 18534687, 21680025, 30217771		★☆☆☆☆ Found in Text Mining only
Manic	Manic Disorder	CTD_human_DG	11772685, 16395126		★☆☆☆☆ Found in Text Mining only
Manic Disorder	Manic Disorder	CTD_human_DG	11772685, 16395126		★☆☆☆☆ Found in Text Mining only
Maternal hypertension	Maternal hypertension	BEFREE	25223859		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	CTD_human_DG	12898347, 18458677, 18686203, 21843009		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	BEFREE	14593433, 18050262, 22247094, 9799087		★☆☆☆☆ Found in Text Mining only
Melancholia	Melancholia	PSYGENET_DG	14593433, 18050262, 20588071, 22247094, 9799087		★☆☆☆☆ Found in Text Mining only
Memory Disorders	Memory disorders	Pubtator	16893493, 17353910, 23266326, 24341893, 26013962, 26393485, 26958025	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Memory Disorders	Memory Disorders	CTD_human_DG	18661256, 18686203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental deficiency	Mental retardation	BEFREE	20175892		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	10624553, 10683861, 10960156, 11027924, 11353442, 11543734, 11729031, 11983186, 12145795, 12478878, 12605095, 12759553, 14508013, 14593433, 15211560, 15263905, 15302939, 15563601, 15699291, 15867107, 15877306, 15879594, 15880108, 16002148, 16005136, 16055263, 16091117, 16095668, 16154545, 16212676, 16288736, 16458264, 16459126, 16476009, 16507957, 16507960, 16541086, 16616982, 16930719, 16934775, 16946185, 16953001, 16965382, 17017823, 17063469, 17094925, 17167343, 17183148, 17216342, 17250473, 17336939, 17353910, 17356577, 17359932, 17408646, 17455215, 17460615, 17481593, 17482146, 17617292, 17618721, 17621167, 17659308, 17700575, 17726476, 17728423, 17804080, 17851196, 17882235, 17909168, 17955359, 18005940, 18050262, 18314311, 18315446, 18330458, 18347599, 18349696, 18450378, 18458677, 18490109, 18495314, 18534686, 18614671, 18618621, 18628680, 18640745, 18691701, 18775088, 18801474, 18973248, 18979110, 18981341, 19015103, 19016475, 19040324, 19083208, 19125390, 19128885, 19192439, 19215635, 19249159, 19251870, 19329228, 19332357, 19339052, 19361959, 19410377, 19429111, 19437301, 19438736, 19468717, 19531786, 19541292, 19573496, 19586232, 19647944, 19675533, 19683026, 19738481, 19853044, 19858108, 19883751, 19885623, 19899843, 19911410, 20010449, 20024596, 20122741, 20196101, 20231323, 20332289, 20351589, 20368500, 20397838, 20403510, 20455953, 20502016, 20509052, 20577990, 20588071, 20606382, 20637828, 20642399, 20685009, 20694965, 20800901, 20881788, 20944177, 20981038, 21034694, 21037213, 21047622, 21129431, 21199959, 21263010, 21368747, 21394855, 21420735, 21423614, 21439648, 21492940, 21496514, 21547899, 21576482, 21593514, 21604315, 21684723, 21722029, 21764567, 21982504, 21996278, 21997575, 22030619, 22094432, 22095773, 22100130, 22119086, 22134442, 22210241, 22225729, 22236459, 22247094, 22291990, 22328412, 22390669, 22414661, 22418015, 22495688, 22520017, 22642841, 22672136, 22693124, 22836288, 22840631, 22847957, 22884012, 22921508, 22951355, 23080078, 23333376, 23481907, 23492930, 23510446, 23547810, 23562852, 23588187, 23643106, 23647137, 23663729, 23672445, 23701535, 23702251, 23766378, 23788696, 23880378, 23893825, 23973249, 23973251, 24035489, 24077031, 24098925, 24219410, 24287203, 24338983, 24374553, 24433089, 24443391, 24462335, 24620999, 24679392, 24779425, 24862560, 24866526, 24937096, 24972569, 24996193, 25078292, 25173097, 25214390, 25226554, 25347540, 25422957, 25422958, 25640317, 25650523, 25688466, 25745133, 25747798, 25760924, 25989139, 25990886, 26016887, 26055783, 26070769, 26093833, 26228411, 26232751, 26262902, 26315979, 26327689, 26330209, 26509115, 26609890, 26909988, 26938215, 26976307, 27005686, 27138797, 27176146, 27277475, 27416920, 27427178, 27515846, 27525827, 27565518, 27701012, 27788383, 27819008, 27826101, 27998510, 28024274, 28142069, 28195567, 28272863, 28325682, 28373689, 28391138, 28416295, 28444137, 28499269, 28533695, 28569537, 28585930, 28629963, 28638109, 28645747, 28652746, 28756191, 28774788, 28892067, 28901577, 28921740, 28935838, 29031184, 29069597, 29094757, 29129791, 29225330, 29331709, 29451287, 29535036, 29547643, 29683385, 29913130, 29982901, 30127611, 30147642, 30176268, 30180828, 30279456, 30306851, 30447571, 30529315, 30718449, 30948693, 31024427, 31181376, 31319341, 31629822, 31784962, 31849623, 9175133, 9577843, 9672904, 9857976		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	PSYGENET_DG	15548484, 23588187, 23678106, 23697793, 24972302, 25422957, 25510949, 25583186		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	10673774, 10676853, 10686552, 11256582, 11324943, 11834311, 12218657, 12860364, 14744464, 15091312, 15187981, 15699291, 15722951, 16082508, 16691130, 16751280, 16969272, 17375136, 17960477, 18349696, 18455241, 18806915, 18827956, 19125107, 19126263, 19288578, 19699062, 19854262, 20192950, 20360351, 20649385, 20862697, 21282783, 21604315, 22921522, 23683292, 24683520, 24914006, 25019689, 25517418, 25688072, 25739526, 26509115, 26519640, 26909988, 27860344, 27880876, 28263187, 28314127, 28391138, 28491024, 28691545, 28824378, 29760654, 30126429, 30473490, 31595439, 31626105, 31804778, 31823595		★☆☆☆☆ Found in Text Mining only
Mental disorders	Mental Disorders	LHGDN	17700575		★☆☆☆☆ Found in Text Mining only
MENTAL RETARDATION, AUTOSOMAL RECESSIVE 60	Mental retardation	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Mesial temporal lobe epilepsy with hippocampal sclerosis	Mesial temporal lobe epilepsy with hippocampal sclerosis	BEFREE	19375285		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	20653450		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	12390616, 12962916, 14668201, 16109120, 16362658, 17563839, 17598758, 19438736, 19845785, 20585826, 20959425, 21450309		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	LHGDN	12962916, 16362658		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	16362658, 17563839, 21206007	Associate	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	BEFREE	15109354, 15642926, 16362658, 16618266, 17101915, 17598758, 19845785, 20959425		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine with Aura	LHGDN	15642926		★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	16362658	Associate	★☆☆☆☆ Found in Text Mining only
Migraine without Aura	Migraine	Pubtator	21206007	Associate	★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	20599283		★☆☆☆☆ Found in Text Mining only
Mitochondrial Complex II Deficiency	Mitochondrial complex deficiency	Pubtator	16452635	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Complex II Deficiency	Mitochondrial Complex Deficiency	BEFREE	29856025		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	16973623, 21257639, 22773688, 29871736, 32329133, 35946926	Associate	★☆☆☆☆ Found in Text Mining only
Mixed anxiety and depressive disorder	Mixed Anxiety And Depressive Disorder	BEFREE	11172874, 18822694, 19759277, 19856660, 20588071, 21142930, 21547899, 28406285, 29683385		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	BEFREE	10089018, 10098839, 10359482, 10395220, 10405095, 10576317, 10611371, 10960164, 11578639, 11913731, 11992558, 12111622, 12582974, 12851635, 12886033, 14735161, 15229244, 15578606, 15627807, 15699291, 15840420, 15849387, 16034444, 16095668, 16186633, 16319503, 16442081, 16510244, 16893493, 16946185, 17003521, 17146470, 17299512, 17392738, 17455215, 17481593, 18450378, 19332357, 19381154, 19685963, 19699062, 19822181, 19878141, 20034565, 20398062, 20851164, 20874521, 21290142, 21356267, 21547899, 22345383, 22488255, 23034517, 23672445, 23702251, 24438559, 25253281, 25451436, 25547397, 25596490, 25711941, 25849128, 26245837, 26519640, 27145764, 27697135, 30457616, 30711709, 9154246, 9399688, 9514579, 9514585, 9543202, 9603609, 9693390, 9787878, 9799087, 9832193		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	10405095, 11505018, 15849387, 16756688, 16893493, 19154632, 19281802, 19864286, 20526950, 20585760, 22148994, 22420614, 22832526, 23034517, 23266326, 24119861, 24438559, 25675343, 26245837, 29348651, 30711709, 33828235, 35246765	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	LHGDN	15167705, 16319504, 17299512		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	CTD_human_DG	19878141		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood disorder	Pubtator	21547899	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	PSYGENET_DG	23678106, 24019939, 24438559, 24862560, 24972302, 25547397, 25596490		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood swings	Mood swings	BEFREE	16893493, 18978318, 20092830		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	11602621	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	28559546	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	15548484, 17353947, 20403608, 26849111		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement disorder	Pubtator	15548484, 23630162, 26849111	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	CTD_human_DG	20929960		★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	29683385		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	12081984, 12605580, 29614501		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	LHGDN	12081984, 12855229		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	28267464	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	27329733	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	27840125	Associate	★☆☆☆☆ Found in Text Mining only
Necrotizing enterocolitis in fetus OR newborn	Necrotizing Enterocolitis	BEFREE	28774871		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15761254, 19308295		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	10970063, 12969257, 14557250, 15737634, 20018729, 22589249, 22939619, 24694346, 24951540, 26010866, 26826449, 28132929, 28398721, 30292559		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	10434306, 11442349, 12499864, 15163634, 20416508, 23931339, 27840125, 28743452, 28821645, 7748555, 8842726, 9700187		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23931339	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	10537061, 19529773, 22891249, 29435951, 31133468, 31491822, 33228685, 33568689, 34586830, 35703323, 37816304, 38128014	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	10090478, 10479410, 10716661, 10766906, 11408619, 12117755, 12490527, 12604778, 12747895, 14999077, 15240759, 15354180, 15598740, 15885086, 15911879, 15967379, 16251441, 16278236, 16416264, 16442295, 16473015, 17012230, 17018277, 17115386, 17213233, 17328689, 17478887, 17503740, 17512917, 17550941, 17596446, 17877635, 17902043, 17941857, 17975550, 18078716, 18184562, 18293418, 18423405, 18549309, 18602275, 18632688, 18923047, 19022249, 19334076, 19394403, 19443488, 19458943, 19464273, 19521824, 19933700, 20145031, 20236390, 20237277, 20556492, 20664076, 20668093, 20852909, 21028906, 21044956, 21117121, 21285520, 21307087, 21336284, 21355047, 21432905, 21713039, 21768291, 21985782, 22052350, 22095086, 22187000, 22198502, 22482451, 22511757, 22556411, 22580459, 22627493, 22815947, 22891249, 22891683, 22892315, 22952026, 22974690, 22974734, 23054839, 23116281, 23131566, 23223017, 23373812, 23455440, 23463025, 23469253, 23557875, 23560303, 23560309, 23583659, 23719918, 23720495, 23898200, 23906595, 23957861, 23980182, 24012756, 24022020, 24381308, 24471944, 24475300, 24494600, 24784230, 24916565, 24926995, 24929669, 25035419, 25307798, 25640796, 25645993, 25703232, 25732261, 25871323, 26165689, 26307259, 26358776, 26459990, 26636336, 26636579, 26642438, 26661162, 26711622, 26876526, 26938440, 27196502, 27377031, 27525439, 27538642, 27615381, 27713486, 27740685, 27815841, 27913616, 27940602, 28000697, 28027448, 28104789, 28129107, 28153533, 28235896, 28359739, 28400517, 28406616, 28445460, 28499347, 28533744, 28590448, 28603746, 28674491, 28771234, 28821645, 28871787, 28971465, 28976800, 29056363, 29134321, 29172480, 29203806, 29207890, 29258536, 29264979, 29302199, 29305855, 29399649, 29582587, 29643462, 29713895, 29802276, 29856014, 29856025, 29858077, 29858092, 29883458, 29945611, 29959348, 30010666, 30107216, 30149534, 30149694, 30185623, 30194046, 30233055, 30254002, 30282695, 30282965, 30355486, 30358836, 30367943, 30391555, 30450032, 30481056, 30587076, 30672003, 30685323, 30766446, 30850940, 30916978, 30941013, 30961637, 31079989, 31133468, 31184975, 31263285, 31282030, 31302194, 31432317, 31648394, 31677786, 31690177, 31712634, 31725947, 31744868, 31745548, 31778667, 31796991, 31810584, 31813995, 31822756, 31828084, 7711729, 7959767, 8643525, 8766138, 8855141, 9398841, 9489526, 9852681		★☆☆☆☆ Found in Text Mining only
Neurodevelopmental Disorders	Neurodevelopmental Disorders	BEFREE	26740508, 27329733		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	11803526		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	10089017, 10405095, 10483054, 10579371, 10629435, 10822346, 10822347, 10893498, 11204348, 11324940, 11505018, 11519933, 11857587, 12130784, 12582974, 12605095, 14659987, 14744464, 14992987, 15108187, 15118354, 15292674, 15802092, 16023085, 16319503, 16534505, 16893493, 16953001, 17216342, 17336939, 17942837, 18004675, 18164547, 18546120, 18628678, 18806915, 19175757, 19199283, 19332357, 19541292, 19683026, 19822181, 20042999, 20440524, 20455953, 20573579, 21142930, 21683756, 22209359, 22420614, 22584505, 22955839, 23382929, 23492930, 24438559, 24630938, 24796636, 24845181, 24874919, 25644221, 25711941, 25833281, 26245837, 27743374, 27788383, 29210327, 29957477, 9175133, 9577843, 9766763, 9783565		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	15000807, 15048655, 16257094, 16582043, 17614196, 18573584, 18991848, 19361959, 19910872, 20031235, 31746558, 9702741		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	BEFREE	31589211		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17124363, 18239643, 18239665, 19411808, 19891962, 22955839, 25680681, 25687785, 26093833, 26698543, 28675387, 28766852, 30738809		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	17124363, 17299098, 18239665, 22290534, 24138674, 26111525, 28675387	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	26381270	Stimulate	★☆☆☆☆ Found in Text Mining only
Obsessive compulsive behavior	Obsessive-Compulsive Disorder	BEFREE	15995945, 21183371		★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	10089018, 10523819, 11602033, 12082589, 15005715, 15108191, 15172105, 15886722, 16220023, 16443280, 16583440, 16642437, 17291658, 17375136, 17503984, 17943026, 18055562, 18186076, 18191318, 18490109, 18957375, 19179283, 19806148, 21245616, 21441009, 22665263, 22727904, 23630162, 25093702, 25751280, 25896187, 26616111, 26986829, 28576508, 29102815, 29331882, 29486157, 30121542, 30554102, 9322235, 9430134, 9672904		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	LHGDN	16642437, 18055562, 18603313, 18957375		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	GENOMICS_ENGLAND_DG	17101915		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	CTD_human_DG	18197083		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Oppositional Defiant Disorder	Oppositional Defiant Disorder	BEFREE	22584505, 24116887, 26184070, 26990675, 30126429		★☆☆☆☆ Found in Text Mining only
Osteochondritis Dissecans	Osteochondritis Dissecans	BEFREE	17943026		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28892067		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	21483275	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	16815388	Associate	★☆☆☆☆ Found in Text Mining only
Painful Bladder Syndrome	Interstitial cystitis	BEFREE	29391756		★☆☆☆☆ Found in Text Mining only
Panic Attacks	Panic Disorder	BEFREE	15346539		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	10335545, 11772685, 12607224, 15274038, 15999296, 16034444, 16822601, 18164547, 18663369, 19259652, 19683026, 20817074, 21688171, 23018769, 23635830, 24342768, 26508020, 27134498, 28096880, 31353282		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	15670397, 18663369, 20817074, 23717480, 27134498, 28391138, 32723321, 32911381, 9413883	Associate	★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	LHGDN	18164547		★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	32723321	Stimulate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11326308, 12392775, 15352068, 16537516, 16973207, 17182613, 17614196, 18973248, 19429111, 19521089, 22010050, 22119730, 24248062, 24684793, 24972569, 28656686, 29305855, 30254002, 30282965, 30515821, 30583877, 30884365, 31103960		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	LHGDN	18073772		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	21450307, 25330023, 28656686	Associate	★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	20817074, 26508020, 31024427		★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	31546689		★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	BEFREE	24906789		★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	28242565		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	22672136		★☆☆☆☆ Found in Text Mining only
Periventricular Nodular Heterotopia	Periventricular nodular heterotopia	Pubtator	33517535	Associate	★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	BEFREE	14992987, 15211560, 19339052, 19894072, 24344840		★☆☆☆☆ Found in Text Mining only
Personality Disorders	Personality Disorders	CTD_human_DG	17000009		★☆☆☆☆ Found in Text Mining only
Pervasive Development Disorder	Autism spectrum disorder	BEFREE	15635668, 16395127, 16698432, 17280648, 20619617, 23123360, 24192574, 28088648, 30394245		★☆☆☆☆ Found in Text Mining only
Phobic anxiety disorder	Phobic Anxiety Disorder	BEFREE	16314764, 25688072, 28391138		★☆☆☆☆ Found in Text Mining only
Pick Disease of the Brain	Pica	BEFREE	25128279, 31810584, 9211185		★☆☆☆☆ Found in Text Mining only
Pituitary Diseases	Pituitary Diseases	BEFREE	19824018		★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	17974934, 19228812, 19444877, 19487392, 19842167, 19884608, 19895335, 20434135, 20441718, 21129431, 21545724, 21608084, 21818827, 21893641, 22095773, 22328412, 22693124, 23103549, 23183127, 23407816, 23825531, 24035489, 24222274, 24532229, 24751314, 25314020, 25793742, 26002549, 27525827, 27619010, 29184054, 29233642, 29280387, 29427306, 30948693, 30983408, 31291228, 31583809, 31727442		★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	29087295, 29433608		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	15000807, 18490109, 19996755, 27283588, 9693390		★☆☆☆☆ Found in Text Mining only
Primary Progressive Nonfluent Aphasia	Nonfluent Aphasia	BEFREE	31810584		★☆☆☆☆ Found in Text Mining only
Progressive cerebellar ataxia	Cerebellar Ataxia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Progressive pseudorheumatoid dysplasia	Progressive Pseudorheumatoid Dysplasia	BEFREE	21099450, 21997575, 23149286, 23394411, 24882202, 31246736		★☆☆☆☆ Found in Text Mining only
Prune Belly Syndrome	Prune belly syndrome	BEFREE	29391756		★☆☆☆☆ Found in Text Mining only
Pseudohyperkalemia Cardiff	Pseudohyperkalemia Cardiff	BEFREE	20332289		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	18979110, 21128207		★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	18979110		★☆☆☆☆ Found in Text Mining only
Psychosis, Involutional	Psychosis	CTD_human_DG	16055263		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	10490703, 11803453, 15000807, 15048655, 16257094, 16582043, 17614196, 18573584, 18991848, 19361959, 19910872, 20031235, 21282783, 21908796, 22520017, 24411530, 29407591, 31746558, 9702741		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	15548484, 19268543, 19361959, 19996755, 21908796	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	16339917, 19141529, 19886858	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	22177971		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	16339917, 19556740, 22319639	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Veno-Occlusive Disease (disorder)	Pulmonary venoocclusive disease	LHGDN	15059929		★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	29551185		★☆☆☆☆ Found in Text Mining only
Recurrent aphthous ulcer	Aphthous Ulcer	BEFREE	16091117, 31550570, 31846848		★☆☆☆☆ Found in Text Mining only
Recurrent depression	Mental Depression	BEFREE	19541292, 22100130, 22840631		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Recurrent depression	Mental Depression	PSYGENET_DG	19541292, 22100130, 22840631		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Recurrent depressive disorder	Mental Depression	BEFREE	22840631		★☆☆☆☆ Found in Text Mining only
Recurrent major depressive episodes	Mental Depression	BEFREE	23663729		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Retinal Dystrophies	Retinal Dystrophy	BEFREE	12471061		★☆☆☆☆ Found in Text Mining only
Retrograde amnesia	Retrograde Amnesia	BEFREE	18614671, 20599283		★☆☆☆☆ Found in Text Mining only
Rett Syndrome	Rett syndrome	Pubtator	27329733	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	36472833	Associate	★☆☆☆☆ Found in Text Mining only
Schizoaffective Disorder	Schizoaffective Disorder	BEFREE	9702741		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10673774, 10962219, 11166082, 11979062, 12478878, 12582974, 12824740, 15048639, 15158428, 15288435, 15627807, 15638952, 15893580, 15940296, 16082508, 16252073, 16274962, 17287080, 17291660, 17886257, 19268543, 19429037, 19439997, 19713975, 19818823, 19995670, 20031235, 20397838, 20451351, 20468059, 21964390, 22414661, 22520017, 22594806, 23583772, 24411530, 25019689, 26408209, 28029428, 28416295, 30643413, 31595439, 9603609, 9848084, 9988839		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	11979062, 12903048, 15940296, 16252073, 16274962, 17287080, 18831910		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	CTD_human_DG	18583979		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	19361959, 22032950, 24411530, 28391138, 33574244, 36641432	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	10089016, 10333377, 10404705, 11244145, 11300730, 11872329, 12877393, 14593433, 14659987, 17882235, 18663369, 23475832, 24260145, 24407753, 29163018, 30077433, 9577843		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	PSYGENET_DG	17882235, 18663369, 23475832, 24260145, 24407753		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Senile cardiac amyloidosis	Senile Cardiac Amyloidosis	BEFREE	24367279		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	31109380		★☆☆☆☆ Found in Text Mining only
Severe depression	Mental Depression	PSYGENET_DG	19567893		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe depression	Mental Depression	BEFREE	30520759		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Severe intellectual disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sexual Dysfunction	Sexual Dysfunction	BEFREE	19204908, 21388237, 31792367		★☆☆☆☆ Found in Text Mining only
Shared Paranoid Disorder	Shared Paranoid Disorder	BEFREE	17875025		★☆☆☆☆ Found in Text Mining only
Sicca Syndrome	Sjogren`s Syndrome	BEFREE	14530202		★☆☆☆☆ Found in Text Mining only
Skin-picking	Skin-picking	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	19014073, 23754303	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep Apnea	LHGDN	16215942		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Syndromes	Sleep apnea	Pubtator	19014073	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	LHGDN	15867649, 19014073		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	19014073, 23494654, 23754303, 24475124, 24755731, 25917830		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sleep Disorders	Sleep Disorders	BEFREE	20685009, 23754303, 25644221, 30948693		★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	28611571		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia 12	Spinocerebellar ataxia	Pubtator	32124191	Associate	★☆☆☆☆ Found in Text Mining only
SPINOCEREBELLAR ATAXIA 17	Spinocerebellar Ataxia	BEFREE	17868456		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 1	Spinocerebellar Ataxia	BEFREE	17984172		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxia Type 7	Spinocerebellar Ataxia	BEFREE	24972706		★☆☆☆☆ Found in Text Mining only
Spinocerebellar Ataxias	Spinocerebellar ataxia	Pubtator	21909428	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	15761254		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28559546	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33882731	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	18981341, 21847802, 33526821, 33923526	Associate	★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet Syndrome	BEFREE	14530202		★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	14530202		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	20395645		★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	25953777		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	30811655		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	31712634	Associate	★☆☆☆☆ Found in Text Mining only
Testicular regression syndrome	Testicular regression syndrome	BEFREE	24680725		★☆☆☆☆ Found in Text Mining only
Thyroid Hormone Resistance Generalized Autosomal Dominant	Thyroid hormone resistance	Pubtator	24033129	Associate	★☆☆☆☆ Found in Text Mining only
Tomaculous neuropathy	Hereditary neuropathy with liability to pressure palsies	Pubtator	33764333	Associate	★☆☆☆☆ Found in Text Mining only
Tourette Syndrome	Tourette syndrome	Pubtator	23630162, 33445578	Associate	★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	BEFREE	24950698		★☆☆☆☆ Found in Text Mining only
Trigeminal Neuralgia	Trigeminal neuralgia	Pubtator	24950698	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	LHGDN	15188158		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	23595519, 25532499		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	10359482, 10780268, 10920459, 11311507, 11817517, 11983186, 12378120, 12476327, 14506400, 15167699, 15312818, 15592465, 15691525, 15842033, 15867106, 15877307, 15879594, 15993855, 16023085, 16055263, 16154545, 16319503, 16390888, 16525076, 16616982, 16930719, 16946185, 17123473, 17284168, 17406646, 17453062, 17544379, 17635185, 17853254, 17886257, 17974934, 17987668, 18286634, 18378990, 18644006, 18848359, 18950748, 19008895, 19125107, 19125390, 19272758, 19288578, 19387615, 19434367, 19475634, 19531786, 20010449, 20016401, 20029939, 20047709, 20147891, 20360314, 20360351, 20380781, 20397838, 20459391, 20584552, 20588071, 20640435, 20800901, 20934189, 20962544, 21492940, 22086748, 22247094, 22921522, 23017007, 23021380, 23095326, 23149035, 23562852, 23618376, 24014145, 24657235, 24858363, 24882202, 24911443, 25510949, 26261165, 26561939, 26879101, 26974654, 26979101, 27023264, 27212180, 27277475, 28638109, 29414128, 29957477, 30447571, 30581206, 30724325, 31629822, 31721892, 7711157, 9799087		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	CTD_human_DG	12898347, 18458677, 18686203, 21843009		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	24679990, 24972302, 25226554, 25510949, 25650523		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Varicosity	Vulval varices	BEFREE	12354780		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	16002749	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	19329228		★☆☆☆☆ Found in Text Mining only
Ventricular Fibrillation, Paroxysmal Familial, 1	Ventricular Fibrillation	BEFREE	23499153		★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	19886858		★☆☆☆☆ Found in Text Mining only
Vitelliform Macular Dystrophy	Vitelliform Macular Dystrophy	BEFREE	27196063		★☆☆☆☆ Found in Text Mining only
West Syndrome	West Syndrome	BEFREE	23775678		★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	29401586		★☆☆☆☆ Found in Text Mining only