BMP5 (bone morphogenetic protein 5)

Gene

• Entrez ID: 653
• Gene name: Bone morphogenetic protein 5
• Gene symbol: BMP5
• Synonyms (NCBI Gene): -
• Chromosome: 6
• Chromosome location: 6p12.1
• Summary: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT610487	hsa-miR-8485	HITS-CLIP	23313552
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23313552
MIRT610487	hsa-miR-8485	HITS-CLIP	23313552
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23313552
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT610484	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT619091	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT630796	hsa-miR-6505-5p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT619091	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT630796	hsa-miR-6505-5p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT610484	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT610484	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT619091	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT630796	hsa-miR-6505-5p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT619091	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT630796	hsa-miR-6505-5p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT610484	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT619091	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT630796	hsa-miR-6505-5p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT619091	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT610484	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	27418678
MIRT610487	hsa-miR-8485	HITS-CLIP	27418678
MIRT610487	hsa-miR-8485	HITS-CLIP	23313552
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23313552
MIRT610487	hsa-miR-8485	HITS-CLIP	23313552
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23313552
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT610484	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT619091	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT630796	hsa-miR-6505-5p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT619091	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT630796	hsa-miR-6505-5p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT610484	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT610484	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT619091	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT630796	hsa-miR-6505-5p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT619091	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT630796	hsa-miR-6505-5p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT610484	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT619091	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT630796	hsa-miR-6505-5p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT619091	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT610487	hsa-miR-8485	HITS-CLIP	23824327
MIRT610486	hsa-miR-5003-5p	HITS-CLIP	23824327
MIRT610485	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT610484	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT610483	hsa-miR-7152-5p	HITS-CLIP	23824327

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001501	Process	Skeletal system development	IEA
GO:0001501	Process	Skeletal system development	NAS	2263636
GO:0001503	Process	Ossification	IEA
GO:0003272	Process	Endocardial cushion formation	IEA
GO:0003272	Process	Endocardial cushion formation	ISS
GO:0003323	Process	Type B pancreatic cell development	IDA	11865031
GO:0003344	Process	Pericardium morphogenesis	IEA
GO:0003344	Process	Pericardium morphogenesis	ISS
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IEA
GO:0005515	Function	Protein binding	IPI	30097509, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IEA
GO:0005615	Component	Extracellular space	ISS
GO:0007389	Process	Pattern specification process	IEA
GO:0007507	Process	Heart development	IBA
GO:0008083	Function	Growth factor activity	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	15516325
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	19584291
GO:0009888	Process	Tissue development	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	NAS	21319131
GO:0010894	Process	Negative regulation of steroid biosynthetic process	IDA	19584291
GO:0021502	Process	Neural fold elevation formation	IEA
GO:0021502	Process	Neural fold elevation formation	ISS
GO:0030154	Process	Cell differentiation	IEA
GO:0030509	Process	BMP signaling pathway	IBA
GO:0030509	Process	BMP signaling pathway	IDA	11580864
GO:0030509	Process	BMP signaling pathway	IEA
GO:0030539	Process	Male genitalia development	IEA
GO:0030902	Process	Hindbrain development	IEA
GO:0030902	Process	Hindbrain development	ISS
GO:0031982	Component	Vesicle	ISS
GO:0032348	Process	Negative regulation of aldosterone biosynthetic process	IDA	19584291
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0043569	Process	Negative regulation of insulin-like growth factor receptor signaling pathway	IDA	19584291
GO:0043583	Process	Ear development	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15516325
GO:0048468	Process	Cell development	IEA
GO:0048738	Process	Cardiac muscle tissue development	IEA
GO:0048738	Process	Cardiac muscle tissue development	ISS
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IDA	11865031
GO:0051094	Process	Positive regulation of developmental process	IEA
GO:0051216	Process	Cartilage development	IEA
GO:0060037	Process	Pharyngeal system development	IEA
GO:0060037	Process	Pharyngeal system development	ISS
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IDA	11580864
GO:0060391	Process	Positive regulation of SMAD protein signal transduction	IEA
GO:0060411	Process	Cardiac septum morphogenesis	IEA
GO:0060411	Process	Cardiac septum morphogenesis	ISS
GO:0060710	Process	Chorio-allantoic fusion	IEA
GO:0060710	Process	Chorio-allantoic fusion	ISS
GO:0061384	Process	Heart trabecula morphogenesis	IEA
GO:0061384	Process	Heart trabecula morphogenesis	ISS
GO:0070700	Function	BMP receptor binding	IDA	7811286
GO:0070700	Function	BMP receptor binding	IEA
GO:0071676	Process	Negative regulation of mononuclear cell migration	NAS	21319131
GO:0097065	Process	Anterior head development	IEA
GO:1900006	Process	Positive regulation of dendrite development	IDA	11580864
GO:1900006	Process	Positive regulation of dendrite development	NAS	9759503
GO:1900006	Process	Positive regulation of dendrite development	TAS	11580864
GO:1902042	Process	Negative regulation of extrinsic apoptotic signaling pathway via death domain receptors	NAS	21319131
GO:1905069	Process	Allantois development	IEA
GO:1905069	Process	Allantois development	ISS
GO:2000065	Process	Negative regulation of cortisol biosynthetic process	IDA	19584291

Other IDs

• MIM: 112265
• HGNC: 1072
• e!Ensembl: ENSG00000112175

Protein

• UniProt ID: P22003
• Protein name: Bone morphogenetic protein 5 (BMP-5)
• Protein function: Growth factor of the TGF-beta superfamily that plays essential roles in many developmental processes, including cartilage and bone formation or neurogenesis (PubMed:11580864, PubMed:29321139). Initiates the canonical BMP signaling cascade by ass
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00688	TGFb_propeptide	31 → 304	TGF-beta propeptide	Family
  PF00019	TGF_beta	352 → 453	Transforming growth factor beta like domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in the lung and liver.
• Sequence:

  MHLTVFLLKGIVGFLWSCWVLVGYAKGGLGDNHVHSSFIYRRLRNHERREIQREILSILG
  LPHRPRPFSPGKQASSAPLFMLDLYNAMTNEENPEESEYSVRASLAEETRGARKGYPASP
  NGYPRRIQLSRTTPLTTQSPPLASLHDTNFLNDADMVMSFVNLVERDKDFSHQRRHYKEF
  RFDLTQIPHGEAVTAAEFRIYKDRSNNRFENETIKISIYQIIKEYTNRDADLFLLDTRKA
  QALDVGWLVFDITVTSNHWVINPQNNLGLQLCAETGDGRSINVKSAGLVGRQGPQSKQPF
  MVAFFKASEVLLRSVRAANKRKNQNRNKSSSHQDSSRMSSVGDYNTSEQKQACKKHELYV
  SFRDLGWQDWIIAPEGYAAFYCDGECSFPLNAHMNATNHAIVQTLVHLMFPDHVPKPCCA
  PTKLNAISVLYFDDSSNVILKKYRNMVVRSCGCH

• Sequence length: 454

Pathways

KEGG:

Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Hippo signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
BMP5-related disorder	Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL SMALL EARS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSOSTOSES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DYSOSTOSIS	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PATELLAR APLASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VESICOURETERAL REFLUX	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of large intestine	Colorectal Cancer	GWASCAT_DG	30510241, 31089142		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	GWASCAT_DG	30510241		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	19584291		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16542506	Inhibit	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24384427		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	32968094	Stimulate	★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	31094703		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	17900349	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23054396		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35054776	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25994008	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	30119170, 30572883		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GWASCAT_DG	30510241, 31089142		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29297384, 29986714, 30572883	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	GWASCAT_DG	30510241, 31089142		★☆☆☆☆ Found in Text Mining only
Congenital Microtia	Congenital Microtia	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Congenital small ears	Microtia	BEFREE	19935299		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital small ears	Microtia	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	16542506, 20021689, 23186552, 23357225, 28695869		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	LHGDN	16542506, 17220169		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	25923336	Associate	★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	17345627		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	12131877	Associate	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	24551273		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	24551273	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	23926243		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23054396		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	GWASCAT_DG	30510241, 31089142		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	GWASCAT_DG	30510241, 31089142		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23054396		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	30553833	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	7572083		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	28778435		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30119170, 30572883		★☆☆☆☆ Found in Text Mining only
Nephrosclerosis	Nephrosclerosis	BEFREE	21319131		★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	LHGDN	11642720		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	16542506	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	16542506	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis	Osteoarthritis	Pubtator	17900349, 23186552, 28695869	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteoarthritis Knee	Osteoarthritis	Pubtator	23186552, 28695869	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	20021689		★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	GWASCAT_DG	30664745		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	23186552, 25030405		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	31094703	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22844442, 37245085	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16542506		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16542506		★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	33034913	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11287276		★☆☆☆☆ Found in Text Mining only
Tumors of Adrenal Cortex	Tumors Of Adrenal Cortex	BEFREE	19584291		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	23926243		★☆☆☆☆ Found in Text Mining only