SLC5A2 (solute carrier family 5 member 2)

Gene

• Entrez ID: 6524
• Gene name: Solute carrier family 5 member 2
• Gene symbol: SLC5A2
• Synonyms (NCBI Gene): SGLT2
• Chromosome: 16
• Chromosome location: 16p11.2
• Summary: This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associat

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121918621	G>A	Pathogenic	Intron variant, coding sequence variant, stop gained
rs200228142	G>A	Pathogenic-likely-pathogenic	Intron variant
rs267607067	A>-	Pathogenic	Non coding transcript variant, frameshift variant, coding sequence variant
rs398122801	C>A,G,T	Pathogenic	Intron variant
rs398122802	C>A,G,T	Pathogenic	Non coding transcript variant, synonymous variant, coding sequence variant, missense variant
rs770214617	->TT	Likely-pathogenic	Coding sequence variant, non coding transcript variant, frameshift variant
rs773289713	G>A,T	Likely-pathogenic	Coding sequence variant, intron variant, missense variant
rs886037850	G>A	Pathogenic	Missense variant, non coding transcript variant, coding sequence variant
rs1378076282	G>A	Pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1555496083	G>-	Pathogenic	Frameshift variant, intron variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT529892	hsa-miR-3155a	PAR-CLIP	22012620
MIRT529891	hsa-miR-3155b	PAR-CLIP	22012620
MIRT529890	hsa-miR-484	PAR-CLIP	22012620
MIRT529889	hsa-miR-4286	PAR-CLIP	22012620
MIRT529887	hsa-miR-6886-5p	PAR-CLIP	22012620
MIRT529888	hsa-miR-6784-3p	PAR-CLIP	22012620
MIRT529886	hsa-miR-6862-3p	PAR-CLIP	22012620
MIRT529884	hsa-miR-3663-3p	PAR-CLIP	22012620
MIRT529885	hsa-miR-4268	PAR-CLIP	22012620
MIRT529883	hsa-miR-6802-3p	PAR-CLIP	22012620
MIRT529892	hsa-miR-3155a	PAR-CLIP	22012620
MIRT529891	hsa-miR-3155b	PAR-CLIP	22012620
MIRT529890	hsa-miR-484	PAR-CLIP	22012620
MIRT529889	hsa-miR-4286	PAR-CLIP	22012620
MIRT529887	hsa-miR-6886-5p	PAR-CLIP	22012620
MIRT529888	hsa-miR-6784-3p	PAR-CLIP	22012620
MIRT529886	hsa-miR-6862-3p	PAR-CLIP	22012620
MIRT529884	hsa-miR-3663-3p	PAR-CLIP	22012620
MIRT529885	hsa-miR-4268	PAR-CLIP	22012620
MIRT529883	hsa-miR-6802-3p	PAR-CLIP	22012620
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT1365385	hsa-miR-134	CLIP-seq
MIRT1365386	hsa-miR-3118	CLIP-seq
MIRT1365387	hsa-miR-4747-5p	CLIP-seq
MIRT2459792	hsa-miR-1229	CLIP-seq
MIRT2459793	hsa-miR-1245b-3p	CLIP-seq
MIRT2459794	hsa-miR-2467-3p	CLIP-seq
MIRT2459795	hsa-miR-296-5p	CLIP-seq
MIRT2459796	hsa-miR-3125	CLIP-seq
MIRT2459797	hsa-miR-3127-3p	CLIP-seq
MIRT2459798	hsa-miR-3150a-3p	CLIP-seq
MIRT2459799	hsa-miR-3154	CLIP-seq
MIRT2459800	hsa-miR-3155	CLIP-seq
MIRT2459801	hsa-miR-3175	CLIP-seq
MIRT2459802	hsa-miR-3179	CLIP-seq
MIRT2459803	hsa-miR-3916	CLIP-seq
MIRT2459804	hsa-miR-4314	CLIP-seq
MIRT2459805	hsa-miR-4434	CLIP-seq
MIRT2459806	hsa-miR-4476	CLIP-seq
MIRT2459807	hsa-miR-4493	CLIP-seq
MIRT2459808	hsa-miR-4514	CLIP-seq
MIRT2459809	hsa-miR-4516	CLIP-seq
MIRT2459810	hsa-miR-4645-5p	CLIP-seq
MIRT2459811	hsa-miR-4667-5p	CLIP-seq
MIRT2459812	hsa-miR-4673	CLIP-seq
MIRT2459813	hsa-miR-4692	CLIP-seq
MIRT2459814	hsa-miR-4700-5p	CLIP-seq
MIRT2459815	hsa-miR-4749-3p	CLIP-seq
MIRT2459816	hsa-miR-637	CLIP-seq
MIRT2459817	hsa-miR-939	CLIP-seq
MIRT2459792	hsa-miR-1229	CLIP-seq
MIRT2459793	hsa-miR-1245b-3p	CLIP-seq
MIRT2459794	hsa-miR-2467-3p	CLIP-seq
MIRT2459795	hsa-miR-296-5p	CLIP-seq
MIRT2459796	hsa-miR-3125	CLIP-seq
MIRT2459799	hsa-miR-3154	CLIP-seq
MIRT2459802	hsa-miR-3179	CLIP-seq
MIRT2459803	hsa-miR-3916	CLIP-seq
MIRT2459805	hsa-miR-4434	CLIP-seq
MIRT2459806	hsa-miR-4476	CLIP-seq
MIRT2459807	hsa-miR-4493	CLIP-seq
MIRT2459808	hsa-miR-4514	CLIP-seq
MIRT2459809	hsa-miR-4516	CLIP-seq
MIRT2459810	hsa-miR-4645-5p	CLIP-seq
MIRT2459812	hsa-miR-4673	CLIP-seq
MIRT2459813	hsa-miR-4692	CLIP-seq
MIRT2459817	hsa-miR-939	CLIP-seq
MIRT2459792	hsa-miR-1229	CLIP-seq
MIRT2459793	hsa-miR-1245b-3p	CLIP-seq
MIRT2626699	hsa-miR-1913	CLIP-seq
MIRT2459794	hsa-miR-2467-3p	CLIP-seq
MIRT2459795	hsa-miR-296-5p	CLIP-seq
MIRT2459796	hsa-miR-3125	CLIP-seq
MIRT2459797	hsa-miR-3127-3p	CLIP-seq
MIRT2459798	hsa-miR-3150a-3p	CLIP-seq
MIRT2459799	hsa-miR-3154	CLIP-seq
MIRT2459801	hsa-miR-3175	CLIP-seq
MIRT2459802	hsa-miR-3179	CLIP-seq
MIRT2626700	hsa-miR-324-3p	CLIP-seq
MIRT2459803	hsa-miR-3916	CLIP-seq
MIRT2459804	hsa-miR-4314	CLIP-seq
MIRT2459805	hsa-miR-4434	CLIP-seq
MIRT2459806	hsa-miR-4476	CLIP-seq
MIRT2459807	hsa-miR-4493	CLIP-seq
MIRT2459808	hsa-miR-4514	CLIP-seq
MIRT2459809	hsa-miR-4516	CLIP-seq
MIRT2459810	hsa-miR-4645-5p	CLIP-seq
MIRT2459811	hsa-miR-4667-5p	CLIP-seq
MIRT2459812	hsa-miR-4673	CLIP-seq
MIRT2459813	hsa-miR-4692	CLIP-seq
MIRT2459814	hsa-miR-4700-5p	CLIP-seq
MIRT2459815	hsa-miR-4749-3p	CLIP-seq
MIRT2459816	hsa-miR-637	CLIP-seq
MIRT2459817	hsa-miR-939	CLIP-seq
MIRT2459792	hsa-miR-1229	CLIP-seq
MIRT2459793	hsa-miR-1245b-3p	CLIP-seq
MIRT2626699	hsa-miR-1913	CLIP-seq
MIRT2459794	hsa-miR-2467-3p	CLIP-seq
MIRT2459795	hsa-miR-296-5p	CLIP-seq
MIRT2459796	hsa-miR-3125	CLIP-seq
MIRT2459797	hsa-miR-3127-3p	CLIP-seq
MIRT2459798	hsa-miR-3150a-3p	CLIP-seq
MIRT2459799	hsa-miR-3154	CLIP-seq
MIRT2459801	hsa-miR-3175	CLIP-seq
MIRT2459802	hsa-miR-3179	CLIP-seq
MIRT2626700	hsa-miR-324-3p	CLIP-seq
MIRT2459803	hsa-miR-3916	CLIP-seq
MIRT2459804	hsa-miR-4314	CLIP-seq
MIRT2459805	hsa-miR-4434	CLIP-seq
MIRT2459806	hsa-miR-4476	CLIP-seq
MIRT2459807	hsa-miR-4493	CLIP-seq
MIRT2459808	hsa-miR-4514	CLIP-seq
MIRT2459809	hsa-miR-4516	CLIP-seq
MIRT2459810	hsa-miR-4645-5p	CLIP-seq
MIRT2459811	hsa-miR-4667-5p	CLIP-seq
MIRT2459812	hsa-miR-4673	CLIP-seq
MIRT2459813	hsa-miR-4692	CLIP-seq
MIRT2459814	hsa-miR-4700-5p	CLIP-seq
MIRT2459815	hsa-miR-4749-3p	CLIP-seq
MIRT2459816	hsa-miR-637	CLIP-seq
MIRT2459817	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000017	Process	Alpha-glucoside transport	IDA	20980548, 26376857
GO:0005362	Function	Low-affinity D-glucose:sodium symporter activity	TAS	8244402
GO:0005412	Function	D-glucose:sodium symporter activity	EXP	11133510
GO:0005412	Function	D-glucose:sodium symporter activity	IBA
GO:0005412	Function	D-glucose:sodium symporter activity	IDA	20980548, 28592437
GO:0005412	Function	D-glucose:sodium symporter activity	TAS
GO:0005515	Function	Protein binding	IPI	28514442, 33961781, 34880493, 38057552
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	26376857
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005975	Process	Carbohydrate metabolic process	TAS	8244402
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006814	Process	Sodium ion transport	IBA
GO:0006814	Process	Sodium ion transport	IEA
GO:0008645	Process	Hexose transmembrane transport	TAS
GO:0015151	Function	Alpha-glucoside transmembrane transporter activity	IDA	20980548, 26376857
GO:0015293	Function	Symporter activity	IEA
GO:0015370	Function	Solute:sodium symporter activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8244402
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035623	Process	Renal D-glucose absorption	IEA
GO:0035623	Process	Renal D-glucose absorption	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0055056	Function	D-glucose transmembrane transporter activity	IDA	20980548
GO:0055085	Process	Transmembrane transport	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0098708	Process	D-glucose import across plasma membrane	IDA	20980548
GO:0098719	Process	Sodium ion import across plasma membrane	IDA	20980548
GO:1904659	Process	D-glucose transmembrane transport	IEA

Other IDs

• MIM: 182381
• HGNC: 11037
• e!Ensembl: ENSG00000140675

Protein

• UniProt ID: P31639
• Protein name: Sodium/glucose cotransporter 2 (Na(+)/glucose cotransporter 2) (Low affinity sodium-glucose cotransporter) (Solute carrier family 5 member 2)
• Protein function: Electrogenic Na(+)-coupled sugar symporter that actively transports D-glucose at the plasma membrane, with a Na(+) to sugar coupling ratio of 1:1 (PubMed:20980548, PubMed:28592437, PubMed:34880493, PubMed:37217492, PubMed:38057552). Transporter
• PDB: 7VSI, 7YNJ, 7YNK, 8HB0, 8HDH, 8HEZ, 8HG7, 8HIN
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00474	SSF	55 → 492	Sodium:solute symporter family	Family

• Sequence:

  MEEHTEAGSAPEMGAQKALIDNPADILVIAAYFLLVIGVGLWSMCRTNRGTVGGYFLAGR
  SMVWWPVGASLFASNIGSGHFVGLAGTGAASGLAVAGFEWNALFVVLLLGWLFAPVYLTA
  GVITMPQYLRKRFGGRRIRLYLSVLSLFLYIFTKISVDMFSGAVFIQQALGWNIYASVIA
  LLGITMIYTVTGGLAALMYTDTVQTFVILGGACILMGYAFHEVGGYSGLFDKYLGAATSL
  TVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWPALLLGLTIVSGWYWCSDQVIVQR
  CLAGKSLTHIKAGCILCGYLKLTPMFLMVMPGMISRILYPDEVACVVPEVCRRVCGTEVG
  CSNIAYPRLVVKLMPNGLRGLMLAVMLAALMSSLASIFNSSSTLFTMDIYTRLRPRAGDR
  ELLLVGRLWVVFIVVVSVAWLPVVQAAQGGQLFDYIQAVSSYLAPPVSAVFVLALFVPRV
  NEQGAFWGLIGGLLMGLARLIPEFSFGSGSCVQPSACPAFLCGVHYLYFAIVLFFCSGLL
  TLTVSLCTAPIPRKHLHRLVFSLRHSKEEREDLDADEQQGSSLPVQNGCPESAMEMNEPQ
  APAPSLFRQCLLWFCGMSRGGVGSPPPLTQEEAAAAARRLEDISEDPSWARVVNLNALLM
  MAVAVFLWGFYA

• Sequence length: 672

Pathways

Reactome:

Cellular hexose transport
Defective SLC5A2 causes renal glucosuria (GLYS1)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Familial renal glucosuria	Likely pathogenic; Pathogenic	rs148410166, rs554372141, rs2082523114, rs886037850, rs749065127, rs764084563, rs121918621, rs768095044, rs2544889035, rs398122801, rs387906682, rs398122802, rs1309307492, rs1555496083, rs773289713, rs987447860, rs770214617	RCV002503164 RCV002506745 RCV003131528 RCV000239563 RCV003324614 RCV003324620 RCV000013767 RCV005021953 RCV003991390 RCV000022761 RCV000408654 RCV000022763 RCV000505656 RCV000625681 RCV000625556 RCV005021123 RCV000991458	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Gastric cancer	Likely pathogenic; Pathogenic	rs768095044	RCV005871154	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SLC5A2-related disorder	Likely pathogenic; Pathogenic	rs764084563, rs768095044, rs757061289, rs753455828, rs767121482	RCV003901011 RCV003419243 RCV003414575 RCV003391670 RCV003393251	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Colon adenocarcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLYCOSURIA, RENAL	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acromegaly	Acromegaly	BEFREE	28323955		★☆☆☆☆ Found in Text Mining only
Acute recurrent pancreatitis	Pancreatitis	BEFREE	30653152		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30429355		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	30429355		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	BEFREE	30402655		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	31294626		★☆☆☆☆ Found in Text Mining only
Aortic Valve Stenosis	Aortic valve stenosis	Pubtator	38247224	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	27866224, 28403850, 28408925, 28683796, 28777298, 28864997, 29518749, 30475996, 31294626, 31784656		★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	30762288		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	39318474	Inhibit	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	29525972		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27866224, 28403850, 28408925, 28683796, 28777298, 28864997, 29518749, 29898853, 30475996, 30920851, 30988077, 31196815, 31219877, 31286271, 31294626, 31410757, 31784656		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	28771923, 28781064		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	31969655	Associate	★☆☆☆☆ Found in Text Mining only
Bladder neck obstruction	Bladder neck obstruction	BEFREE	28536217		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	28725912, 29039237, 30972917, 31741440		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	31776304		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31776304	Associate	★☆☆☆☆ Found in Text Mining only
Bullous pemphigoid	Bullous Pemphigoid	BEFREE	31605541		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	35977549	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29130831		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	28725912, 29039237, 30972917, 31741440		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11509120, 30365049, 30429355		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	30521176	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	28052965, 31125563		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	30857271		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	27653447, 27941935, 28086951, 28153377, 28324025, 28743130, 28836359, 28864997, 28990512, 29061576, 29297732, 29320602, 29402981, 29589153, 29748368, 29852973, 29858866, 29895330, 30039524, 30251174, 30256723, 30265814, 30266577, 30519831, 30607467, 30621568, 30704605, 30767677, 30810055, 30835599, 30888088, 30895697, 30904510, 30988077, 31150300, 31261624, 31264765, 31352613, 31359366, 31381891, 31405756, 31412874, 31440988, 31456521, 31479704, 31602601, 31647926, 31721613, 31778623, 31780586, 31816162, 31839265		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	31491943		★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	40404687	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	39542148	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	27895093, 28522196, 28771923, 29285488, 29569378, 29573118, 30653708, 30697905, 31467044, 31792991		★☆☆☆☆ Found in Text Mining only
Chronic heart failure	Heart Failure	BEFREE	29042392		★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	29792136, 31261624, 31495651, 31707795		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23461781, 26741142, 27660122, 27878313, 28663934, 28667063, 29291819, 29361669, 29954951, 29983235, 30076706, 30089717, 30132035, 30143067, 30207040, 30284913, 30449220, 30697905, 30708071, 30753708, 30762288, 30767677, 30790503, 30929540, 31050116, 31101403, 31133455, 31198226, 31377891, 31456521, 31663470, 31781668, 31813656, 31824432		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31638239		★☆☆☆☆ Found in Text Mining only
Congenital glucose-galactose malabsorption	Congenital glucose-galactose malabsorption	BEFREE	21049241, 30132033		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27653447, 27866027, 28043708, 28291655, 28391552, 28403850, 28526183, 28526185, 28606342, 28606344, 28643218, 28692750, 28721687, 28756774, 28781064, 29016751, 29024278, 29042392, 29061576, 29270818, 29320602, 29322280, 29353233, 29359851, 29361669, 29368701, 29372664, 29415819, 29520964, 29549573, 29589153, 29604389, 29677303, 29679303, 29695659, 29704192, 29735306, 29801492, 29895290, 29898853, 29938883, 29954951, 30015065, 30039524, 30066584, 30093883, 30132035, 30132036, 30149104, 30196071, 30265814, 30296931, 30406850, 30463454, 30472914, 30519189, 30524708, 30553441, 30586745, 30604504, 30607467, 30618324, 30653708, 30665953, 30675708, 30697905, 30704605, 30713085, 30732594, 30767126, 30767677, 30817235, 30822172, 30843294, 30888088, 30895697, 30904510, 30920851, 30992077, 31033127, 31050116, 31082854, 31105148, 31161798, 31176543, 31219877, 31227014, 31264765, 31277431, 31291624, 31337395, 31359366, 31381891, 31400090, 31408637, 31410711, 31410757, 31412874, 31436559, 31440988, 31442511, 31456369, 31456521, 31462224, 31467044, 31474116, 31486272, 31494110, 31522263, 31523904, 31535829, 31583647, 31584231, 31585532, 31627834, 31630988, 31663470, 31676303, 31693879, 31707794, 31707795, 31721613, 31725011, 31726765, 31738936, 31741436, 31741439, 31747132, 31778623, 31780586, 31804229, 31816162, 31821814, 31837891, 31839265, 31841369		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28763435, 30521176		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28536852, 29061576, 29991346, 31004234, 31585532, 31821814		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	28536852, 29061576, 30988077, 31585532, 31631099		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	28536852, 29061576, 31585532		★☆☆☆☆ Found in Text Mining only
Deep Vein Thrombosis	Thrombosis	BEFREE	31050384		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	31437816		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	28214518		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	30008607		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	23042029, 23508966, 25554066, 26158396, 27000029, 27288013, 27356542, 27696231, 27773781, 27913012, 27977314, 27978521, 28086951, 28106956, 28134748, 28214518, 28303514, 28419670, 28448895, 28506519, 28506912, 28538386, 28584109, 28635308, 28646701, 28677333, 28692750, 28736981, 28759755, 28835229, 28861952, 28871349, 29039237, 29144539, 29212386, 29213337, 29216560, 29247356, 29361669, 29368701, 29415819, 29482993, 29483060, 29704192, 29717156, 29911393, 29954951, 29984503, 30021702, 30132034, 30132036, 30240793, 30253050, 30266577, 30345926, 30443936, 30444646, 30476138, 30484350, 30524708, 30553441, 30586745, 30621568, 30635569, 30663458, 30688052, 30762288, 30767126, 30790503, 30895697, 30914436, 30930073, 31026402, 31050099, 31064213, 31064765, 31101403, 31105148, 31167663, 31209982, 31262142, 31305690, 31325786, 31352613, 31359514, 31371973, 31400090, 31410757, 31437852, 31456369, 31497874, 31523904, 31525753, 31584231, 31585532, 31612835, 31630988, 31641524, 31647926, 31652578, 31707794, 31741057, 31813092, 31842574		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	22310849, 23042029, 23390498, 23508966, 25554066, 26158396, 27000029, 27288013, 27356542, 27696231, 27773781, 27898586, 27913012, 27977314, 27978521, 28043708, 28086951, 28106956, 28120716, 28134748, 28214518, 28303514, 28419670, 28448895, 28506519, 28506912, 28538386, 28584109, 28635308, 28646701, 28677333, 28692750, 28736981, 28759755, 28835229, 28861952, 28871349, 29039237, 29144539, 29212386, 29213337, 29216560, 29247356, 29330646, 29361669, 29368701, 29415819, 29482993, 29483060, 29608898, 29704192, 29717156, 29848274, 29879920, 29911393, 29954951, 29984503, 30021702, 30084579, 30132034, 30132036, 30240793, 30246286, 30253050, 30266577, 30291295, 30338502, 30345926, 30443936, 30444646, 30475996, 30476138, 30484350, 30524708, 30531609, 30553441, 30559106, 30577089, 30586745, 30621568, 30635569, 30663266, 30663458, 30688052, 30704605, 30738330, 30753708, 30762288, 30767126, 30790503, 30895697, 30914436, 30930073, 30988077, 31026402, 31050099, 31064213, 31064765, 31101403, 31105148, 31145707, 31167663, 31209982, 31261624, 31262142, 31305690, 31325786, 31352613, 31359514, 31371973, 31400090, 31410757, 31437852, 31456369, 31491943, 31494110, 31497874, 31523904, 31525753, 31584231, 31585532, 31612835, 31630988, 31638239, 31641524, 31647926, 31652578, 31682172, 31700865, 31707794, 31707795, 31741057, 31813092, 31842574		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30291295	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	30476138, 34500107, 35129424, 35229480, 35498407, 36096423	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	26735923, 27611858, 28472182, 29341404, 34325887, 35879337, 37543256	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	27899497, 27918226, 28099783, 28276512, 28381459, 28524098, 28535688, 28587531, 28736981, 29068709, 29317332, 29451721, 29663292, 29794497, 29796246, 29916741, 29937430, 29991320, 30565398, 30688521, 30833371, 31081593, 31183975, 31197753, 31334593, 31585721, 31601640, 31644310, 31664708, 31807264, 31813092, 31816431		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	16306358, 19357717, 19965550, 20539226, 21606218, 21830867, 23651029, 25450362, 27012770, 27155214, 27389050, 27535028, 27598833, 27605629, 27611858, 27652617, 27718782, 27773781, 27817207, 27841020, 27862830, 27863704, 27866027, 27866701, 27878313, 27894216, 27925353, 27941935, 27977934, 27981497, 27990776, 27995594, 28039605, 28077257, 28098449, 28099783, 28100918, 28102030, 28106956, 28116795, 28121337, 28131071, 28132008, 28134748, 28138853, 28138980, 28153377, 28176222, 28177187, 28178390, 28240446, 28241822, 28244288, 28253918, 28277831, 28303514, 28322073, 28323512, 28324025, 28324484, 28325783, 28332143, 28332871, 28351176, 28371205, 28376855, 28387957, 28391552, 28391584, 28391776, 28395363, 28395380, 28395981, 28403850, 28403877, 28422431, 28426260, 28431476, 28431667, 28437153, 28440009, 28440199, 28440590, 28447076, 28447181, 28447791, 28448895, 28458353, 28472182, 28477418, 28490557, 28490565, 28506912, 28524098, 28526179, 28526183, 28526185, 28536217, 28536852, 28538386, 28542373, 28546454, 28579198, 28588220, 28593615, 28596160, 28606342, 28606344, 28606346, 28616806, 28646701, 28657399, 28663934, 28666775, 28669625, 28682870, 28683796, 28703316, 28717146, 28721687, 28725912, 28736981, 28741382, 28743130, 28749169, 28756774, 28763435, 28769002, 28771923, 28781064, 28785316, 28786530, 28797524, 28827404, 28833358, 28836175, 28836359, 28837785, 28840014, 28846182, 28857451, 28860019, 28861952, 28864997, 28898514, 28942789, 29016751, 29022746, 29025400, 29029369, 29031006, 29032638, 29042751, 29061576, 29074329, 29098566, 29110406, 29144574, 29165885, 29174031, 29185199, 29193543, 29196150, 29271103, 29282633, 29291819, 29301520, 29306791, 29313282, 29317332, 29320602, 29322280, 29327406, 29334278, 29341404, 29344329, 29349558, 29359851, 29369494, 29372664, 29374293, 29375082, 29376760, 29411292, 29415819, 29449146, 29459554, 29473709, 29477373, 29477576, 29482993, 29483060, 29488164, 29498469, 29507611, 29508169, 29520964, 29525972, 29535389, 29573110, 29573118, 29589153, 29602453, 29604389, 29608505, 29638185, 29649541, 29663292, 29669938, 29674332, 29677303, 29679303, 29693360, 29702076, 29703207, 29709913, 29737015, 29748368, 29764742, 29766812, 29777264, 29783787, 29794497, 29801492, 29802956, 29848274, 29852973, 29866460, 29885762, 29895290, 29895330, 29895557, 29898853, 29911393, 29931506, 29938883, 29944969, 29946963, 29954951, 29961013, 29975575, 29984503, 29998370, 30015065, 30017776, 30025475, 30030256, 30032729, 30039249, 30039524, 30047217, 30051943, 30060748, 30066584, 30068236, 30072956, 30093883, 30095664, 30105373, 30113651, 30118626, 30132031, 30132032, 30132033, 30132034, 30132035, 30136398, 30148719, 30149145, 30170758, 30191537, 30196071, 30206656, 30207040, 30207042, 30223693, 30224193, 30237717, 30249630, 30253050, 30255388, 30256723, 30261527, 30265814, 30270426, 30284913, 30290289, 30294953, 30296931, 30394576, 30402655, 30406850, 30412008, 30415909, 30420836, 30424892, 30427588, 30449220, 30463454, 30469144, 30484350, 30502742, 30503071, 30517896, 30522346, 30524708, 30531609, 30537226, 30539648, 30552292, 30565386, 30618324, 30621212, 30631892, 30639796, 30641163, 30653152, 30653708, 30684076, 30685222, 30688052, 30697905, 30704605, 30708071, 30710997, 30711143, 30713085, 30738154, 30759121, 30762288, 30767677, 30810254, 30819210, 30828082, 30830656, 30833170, 30835599, 30843877, 30862658, 30866088, 30866531, 30877709, 30882238, 30888088, 30895697, 30912033, 30920851, 30921791, 30928954, 30929540, 30930073, 30938372, 30939483, 30953516, 30954510, 30958403, 30964362, 30972878, 30983141, 30988077, 30990260, 31001673, 31013163, 31026402, 31027990, 31030051, 31041606, 31041781, 31050099, 31050116, 31050384, 31081592, 31114700, 31120717, 31130574, 31132013, 31138195, 31143117, 31153131, 31159350, 31161798, 31176543, 31191559, 31197753, 31198224, 31198226, 31201711, 31208401, 31219877, 31227014, 31234839, 31237132, 31237921, 31264758, 31264765, 31275246, 31286271, 31294626, 31321581, 31325786, 31326453, 31326454, 31331468, 31334593, 31359366, 31364269, 31372172, 31376072, 31377891, 31382965, 31391764, 31400090, 31401152, 31402716, 31407856, 31408637, 31408894, 31412874, 31423699, 31434508, 31437852, 31440988, 31444707, 31451424, 31456521, 31462224, 31474116, 31477497, 31485187, 31486260, 31486272, 31489272, 31489568, 31495651, 31506585, 31522263, 31530577, 31530665, 31535829, 31537607, 31537914, 31540867, 31541572, 31551068, 31580737, 31582658, 31583647, 31584231, 31585532, 31585721, 31602601, 31606880, 31616297, 31627834, 31630053, 31630988, 31640705, 31642583, 31647926, 31663470, 31677134, 31681978, 31686263, 31688975, 31721613, 31722710, 31723537, 31724039, 31725011, 31741436, 31741437, 31741439, 31747132, 31757028, 31769309, 31779619, 31780586, 31781664, 31791665, 31804352, 31806203, 31807264, 31813656, 31815146, 31816162, 31816432, 31839265, 31841369		★☆☆☆☆ Found in Text Mining only
Diabetic Cardiomyopathies	Diabetic cardiomyopathy	BEFREE	28447181, 29991346, 31410757		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic Ketoacidosis	BEFREE	27931088, 27990776, 28099783, 28102030, 28276512, 28323955, 28437153, 28500396, 28570924, 28597228, 29157798, 29451721, 29569427, 29663292, 29916741, 30209797, 30565398, 30639566, 30813108, 30835263, 30880915, 31065934, 31081593, 31334593, 31489272, 31494110, 31529090, 31585721, 31601640, 31686263, 31694774, 31743484		★☆☆☆☆ Found in Text Mining only
Diabetic Ketoacidosis	Diabetic ketoacidosis	Pubtator	38277514	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31545924	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	31862399, 34200774, 34285121, 35129424, 36314849, 36768138, 38069385	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	23390498, 23508966, 26158396, 28196866, 28295491, 28444472, 28511711, 28524098, 28535208, 28667063, 28743130, 28759755, 28840540, 29084249, 29145743, 29508169, 29523130, 29589183, 29635129, 29702076, 29735306, 29792136, 29866460, 29880432, 29949175, 30089717, 30484350, 30559106, 30665953, 30672815, 30742277, 30843294, 30886225, 30997935, 31001673, 31168342, 31198226, 31291624, 31337395, 31367234, 31545924, 31611596, 31693730, 31725011		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29369494, 30123269		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28120716		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29879920		★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	31969655	Associate	★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29923997		★☆☆☆☆ Found in Text Mining only
Familial renal glucosuria	Renal Glucosuria	ORPHANET_DG	14614622, 21165652, 24255686		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial renal glucosuria	Renal Glucosuria	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial renal glucosuria	Renal Glucosuria	BEFREE	15610225, 16518345, 18622023, 19965550, 21049241, 21165652, 21358700, 22314875, 23651029, 23871407, 25339128, 25896487, 26735923, 27000029, 28365451, 30593819, 30942416, 31081587, 31584752		★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Fanconi-Bickel Syndrome	Fanconi-Bickel Syndrome	BEFREE	19965550		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	27754601, 30708071, 30810254, 31391764		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	35842345	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28677333, 29402900, 30684076, 30984539, 31652578		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	30984539		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	29141939		★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	29484489, 31616297		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29525972		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29525972		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	31545924		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	31545924	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	26741142, 29792136		★☆☆☆☆ Found in Text Mining only
Glycosuria Renal	Renal glycosuria	Pubtator	15610225, 16518345, 26376857, 26735923, 27000029, 30476138, 30558067, 31584752, 32034166, 32111189, 35229480	Associate	★☆☆☆☆ Found in Text Mining only
Glycosuria, Renal	Glycosuria, Renal	BEFREE	12436245, 14569097, 14614622, 15110322, 15610225, 25339128, 26735923, 28324025, 30558067, 30684076		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycosuria, Renal	Glycosuria, Renal	CLINVAR_DG	14569097, 18622023		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycosuria, Renal	Glycosuria, Renal	ORPHANET_DG	14614622, 21165652, 24255686		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycosuria, Renal	Glycosuria, Renal	UNIPROT_DG	14614622		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycosuria, Renal	Glycosuria, Renal	GENOMICS_ENGLAND_DG	26376857		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glycosuria, Renal	Glycosuria, Renal	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Heart Diseases	Heart Diseases	BEFREE	28692750		★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	38247224	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27653447, 27866027, 28043708, 28291655, 28391552, 28403850, 28526183, 28526185, 28606342, 28606344, 28643218, 28692750, 28721687, 28756774, 28781064, 29016751, 29024278, 29042392, 29061576, 29270818, 29320602, 29322280, 29353233, 29359851, 29361669, 29368701, 29372664, 29415819, 29520964, 29549573, 29604389, 29677303, 29679303, 29695659, 29704192, 29735306, 29801492, 29895290, 29898853, 29938883, 29954951, 30015065, 30039524, 30066584, 30093883, 30132035, 30132036, 30149104, 30196071, 30265814, 30296931, 30406850, 30463454, 30472914, 30519189, 30524708, 30553441, 30586745, 30604504, 30607467, 30618324, 30653708, 30675708, 30697905, 30704605, 30713085, 30732594, 30767126, 30767677, 30817235, 30822172, 30843294, 30888088, 30895697, 30904510, 30920851, 30992077, 31033127, 31050116, 31082854, 31105148, 31161798, 31176543, 31219877, 31227014, 31264765, 31277431, 31291624, 31337395, 31359366, 31381891, 31400090, 31408637, 31410711, 31410757, 31412874, 31436559, 31440988, 31442511, 31456369, 31456521, 31462224, 31467044, 31474116, 31486272, 31494110, 31522263, 31523904, 31535829, 31583647, 31584231, 31585532, 31627834, 31630988, 31663470, 31676303, 31693879, 31707794, 31707795, 31721613, 31725011, 31726765, 31738936, 31741436, 31741439, 31747132, 31778623, 31780586, 31804229, 31816162, 31837891, 31839265, 31841369		★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30291295, 34028657, 34540994, 39217550	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure Diastolic	Heart failure	Pubtator	36549862	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure Systolic	Heart failure	Pubtator	36303443	Associate	★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	30261527, 30338502		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	19357717, 21358700, 22314875, 23508966, 27748201, 27878313, 27977314, 28102030, 28118069, 28246292, 28277831, 28391584, 28458353, 28477418, 28506912, 28511711, 28725273, 28741382, 28769002, 29216560, 29297732, 29361669, 29375082, 29488164, 29663292, 29674332, 29702076, 29709913, 29923997, 29931506, 30060748, 30097993, 30118626, 30151080, 30209797, 30227329, 30261527, 30444646, 30447687, 30469144, 30524708, 30708071, 30717173, 30930073, 31166707, 31537607, 31663470, 31682172		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	33588940	Associate	★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	20539226, 30597042		★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	28777298, 31050099		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	26741142, 27895093, 28120716, 28351176, 29061576, 29349558, 29402981, 30093883, 30113526, 30261527, 30586745, 30921791, 31065993, 31537914, 31541572, 31616297, 31673025		★☆☆☆☆ Found in Text Mining only
hypertensive nephropathy	Hypertensive Nephropathy	BEFREE	28667063		★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	28846182, 29673309, 31485187		★☆☆☆☆ Found in Text Mining only
Hypobetalipoproteinemias	Hypoalphalipoproteinemia	Pubtator	35842345	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	20539226, 22310849, 27665059, 27995594, 28535688, 28538386, 28643218, 28682870, 28812381, 28864997, 28942789, 29025285, 29029369, 29039237, 29196150, 29205774, 29334278, 29353233, 29451721, 29507611, 29649541, 29663292, 29673309, 29802956, 29895330, 30155646, 30246878, 30469144, 30565398, 30639796, 30670968, 30901912, 31041606, 31081593, 31183975, 31376072, 31489272, 31778623, 31813092, 31839265		★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	26735923, 31584752, 32034166	Associate	★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	30866531		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	29476696, 32100949, 35498407	Associate	★☆☆☆☆ Found in Text Mining only
Iron deficiency anemia	Iron deficiency anemia	BEFREE	31082854		★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	31585532		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28522196, 31804352		★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	27717592, 28099783, 28570924, 28736981, 29074329, 29144574, 29320602, 30607467, 30653152, 30670968, 30710078, 30954957, 30968118, 31525753, 31741440		★☆☆☆☆ Found in Text Mining only
Kidney Calculi	Kidney stone	BEFREE	31401152		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	27748201, 27977314, 27978521, 28196866, 28482281, 28506912, 28721687, 28743130, 28759755, 29349558, 29374293, 29482993, 29604389, 29702076, 29735306, 29792136, 29911393, 30060748, 30089717, 30929540, 31291624, 31310751, 31377891, 31410711, 31440988, 31495651, 31506585, 31537914, 31545924, 31561285, 31627834, 31693730, 31725011, 31757028		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	31862399	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	31159350, 31495651		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28083972, 28637789, 28827404, 28952138, 29174031, 29954951, 30084579, 30207040, 30429124, 30670968, 30813108, 30939483, 31050116, 31150300, 31495651, 31815757, 31815931, 31824432		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	29792136, 31261624, 31495651, 31707795		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	28835229		★☆☆☆☆ Found in Text Mining only
Lipoid nephrosis	Lipoid Nephrosis	BEFREE	21165652		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28938561, 29205334, 29402900, 31652578		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	31652578		★☆☆☆☆ Found in Text Mining only
Long Qt Syndrome 2	Long qt syndrome	Pubtator	26376857	Associate	★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	39318474	Inhibit	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	11509120	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30429355		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	31776304		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	28938561, 29205334		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11509120, 30365049, 30429355		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	30039616		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	28725912, 29039237, 30972917, 31741440		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27773781, 28725912, 29039237, 29205334, 30972917, 31638239, 31741440		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	30039616		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	28214518		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	31497874		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	36096423	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	28277831, 28938561, 30444646		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	27866027, 28542373, 28781064, 29353233, 29372664, 29569378, 29677303, 30291295, 30552292, 30939483, 31033127, 31467044, 31707795, 31738936, 31804352		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	30291295	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29991346, 31004234		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28763435, 29205334, 30089592, 31652578		★☆☆☆☆ Found in Text Mining only
Nephrolithiasis	Nephrolithiasis	BEFREE	31401152		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	25450362		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27660122, 27925353, 28938561, 29895557, 30577089, 30708071, 30810254, 31391764, 31497874, 31672448		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30089592		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	29402900, 30684076, 30742277, 30984539, 31561285, 31652578		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	27876617, 28506912, 29098566, 29301371, 29931506, 30253050, 30701480, 30972878, 31383344, 31517956		★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29132091		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	35662245	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatic Diseases	Pancreatic Diseases	BEFREE	29335890		★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	30195639, 31150722		★☆☆☆☆ Found in Text Mining only
Peripheral arterial stenosis	Peripheral arterial stenosis	BEFREE	30195639, 31150722		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	30195639		★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	Pubtator	36966432	Associate	★☆☆☆☆ Found in Text Mining only
Prader-Willi Syndrome	Prader-Willi Syndrome	BEFREE	29335890		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	31437816		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29525972		★☆☆☆☆ Found in Text Mining only
Proteinuria	Proteinuria	Pubtator	30476138	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	38325821	Associate	★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	31763787		★☆☆☆☆ Found in Text Mining only
Reactive hypoglycemia	Reactive hypoglycemia	BEFREE	26735923		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	28763435, 30521176		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	30045814		★☆☆☆☆ Found in Text Mining only
Renal glomerular disease	Renal Glomerular Disease	BEFREE	30089717		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	27748201, 27977314, 29482993, 29667921, 30767677, 30929540, 31132013, 31377891, 31456521, 31707795		★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	28535208		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	31763787		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29459554		★☆☆☆☆ Found in Text Mining only
Sleep-Disordered Breathing	Sleep Apnea	BEFREE	30047511		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	27754601, 28506912, 30708071, 30810254, 30984539, 31391764, 31700865		★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	11325687		★☆☆☆☆ Found in Text Mining only
Vaginitis	Vaginitis	BEFREE	30136398		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	29307883	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	31294626		★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	38247224	Associate	★☆☆☆☆ Found in Text Mining only