Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6518
Gene name	Solute carrier family 2 member 5
Gene symbol	SLC2A5
Synonyms (NCBI Gene)	GLUT-5GLUT5
Chromosome	1
Chromosome location	1p36.23
Summary	The protein encoded by this gene is a fructose transporter responsible for fructose uptake by the small intestine. The encoded protein also is necessary for the increase in blood pressure due to high dietary fructose consumption. [provided by RefSeq, Jun

Show/Hide all (91)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021373	hsa-miR-9-5p	Microarray	17612493
MIRT692267	hsa-miR-6815-5p	HITS-CLIP	23313552
MIRT692266	hsa-miR-6865-5p	HITS-CLIP	23313552
MIRT692265	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT692264	hsa-miR-3184-5p	HITS-CLIP	23313552
MIRT692263	hsa-miR-423-5p	HITS-CLIP	23313552
MIRT692262	hsa-miR-1914-3p	HITS-CLIP	23313552
MIRT692261	hsa-miR-5194	HITS-CLIP	23313552
MIRT692260	hsa-miR-6738-5p	HITS-CLIP	23313552
MIRT692259	hsa-miR-3135a	HITS-CLIP	23313552
MIRT692258	hsa-miR-6802-5p	HITS-CLIP	23313552
MIRT692257	hsa-miR-7977	HITS-CLIP	23313552
MIRT692256	hsa-miR-6834-5p	HITS-CLIP	23313552
MIRT692255	hsa-miR-1226-5p	HITS-CLIP	23313552
MIRT692254	hsa-miR-6734-5p	HITS-CLIP	23313552
MIRT692253	hsa-miR-1304-5p	HITS-CLIP	23313552
MIRT550589	hsa-miR-512-5p	PAR-CLIP	21572407
MIRT550588	hsa-miR-510-5p	PAR-CLIP	21572407
MIRT550587	hsa-miR-4695-5p	PAR-CLIP	21572407
MIRT550586	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT550585	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT550584	hsa-miR-940	PAR-CLIP	21572407
MIRT550583	hsa-miR-3929	PAR-CLIP	21572407
MIRT550582	hsa-miR-4419b	PAR-CLIP	21572407
MIRT550581	hsa-miR-4478	PAR-CLIP	21572407
MIRT550580	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT550579	hsa-miR-4459	PAR-CLIP	21572407
MIRT550578	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT550577	hsa-miR-3664-3p	PAR-CLIP	21572407
MIRT550576	hsa-miR-4649-3p	PAR-CLIP	21572407
MIRT550575	hsa-miR-4790-3p	PAR-CLIP	21572407
MIRT550574	hsa-miR-1827	PAR-CLIP	21572407
MIRT550573	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT550572	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT550571	hsa-miR-4722-5p	PAR-CLIP	21572407
MIRT550569	hsa-miR-7160-5p	PAR-CLIP	21572407
MIRT550570	hsa-miR-3650	PAR-CLIP	21572407
MIRT550568	hsa-miR-665	PAR-CLIP	21572407
MIRT550574	hsa-miR-1827	PAR-CLIP	27292025
MIRT550570	hsa-miR-3650	PAR-CLIP	27292025
MIRT550576	hsa-miR-4649-3p	PAR-CLIP	27292025
MIRT550571	hsa-miR-4722-5p	PAR-CLIP	27292025
MIRT550580	hsa-miR-4768-3p	PAR-CLIP	27292025
MIRT550575	hsa-miR-4790-3p	PAR-CLIP	27292025
MIRT550568	hsa-miR-665	PAR-CLIP	27292025
MIRT550586	hsa-miR-6808-5p	PAR-CLIP	27292025
MIRT550585	hsa-miR-6893-5p	PAR-CLIP	27292025
MIRT550569	hsa-miR-7160-5p	PAR-CLIP	27292025
MIRT550584	hsa-miR-940	PAR-CLIP	27292025
MIRT692267	hsa-miR-6815-5p	HITS-CLIP	23313552
MIRT692266	hsa-miR-6865-5p	HITS-CLIP	23313552
MIRT692265	hsa-miR-383-3p	HITS-CLIP	23313552
MIRT692264	hsa-miR-3184-5p	HITS-CLIP	23313552
MIRT692263	hsa-miR-423-5p	HITS-CLIP	23313552
MIRT692262	hsa-miR-1914-3p	HITS-CLIP	23313552
MIRT692261	hsa-miR-5194	HITS-CLIP	23313552
MIRT692260	hsa-miR-6738-5p	HITS-CLIP	23313552
MIRT692259	hsa-miR-3135a	HITS-CLIP	23313552
MIRT692258	hsa-miR-6802-5p	HITS-CLIP	23313552
MIRT692257	hsa-miR-7977	HITS-CLIP	23313552
MIRT692256	hsa-miR-6834-5p	HITS-CLIP	23313552
MIRT692255	hsa-miR-1226-5p	HITS-CLIP	23313552
MIRT692254	hsa-miR-6734-5p	HITS-CLIP	23313552
MIRT692253	hsa-miR-1304-5p	HITS-CLIP	23313552
MIRT550589	hsa-miR-512-5p	PAR-CLIP	21572407
MIRT550588	hsa-miR-510-5p	PAR-CLIP	21572407
MIRT550587	hsa-miR-4695-5p	PAR-CLIP	21572407
MIRT550586	hsa-miR-6808-5p	PAR-CLIP	21572407
MIRT550585	hsa-miR-6893-5p	PAR-CLIP	21572407
MIRT550584	hsa-miR-940	PAR-CLIP	21572407
MIRT550583	hsa-miR-3929	PAR-CLIP	21572407
MIRT550582	hsa-miR-4419b	PAR-CLIP	21572407
MIRT550581	hsa-miR-4478	PAR-CLIP	21572407
MIRT550580	hsa-miR-4768-3p	PAR-CLIP	21572407
MIRT550579	hsa-miR-4459	PAR-CLIP	21572407
MIRT550578	hsa-miR-4433a-3p	PAR-CLIP	21572407
MIRT550577	hsa-miR-3664-3p	PAR-CLIP	21572407
MIRT550576	hsa-miR-4649-3p	PAR-CLIP	21572407
MIRT550575	hsa-miR-4790-3p	PAR-CLIP	21572407
MIRT550574	hsa-miR-1827	PAR-CLIP	21572407
MIRT550573	hsa-miR-485-5p	PAR-CLIP	21572407
MIRT550572	hsa-miR-6884-5p	PAR-CLIP	21572407
MIRT550571	hsa-miR-4722-5p	PAR-CLIP	21572407
MIRT550569	hsa-miR-7160-5p	PAR-CLIP	21572407
MIRT550570	hsa-miR-3650	PAR-CLIP	21572407
MIRT550568	hsa-miR-665	PAR-CLIP	21572407
MIRT755815	hsa-miR-92a-1-5p	Luciferase reporter assayWestern blottingqRT-PCR	35734423
MIRT1359008	hsa-miR-185	CLIP-seq
MIRT1359009	hsa-miR-4306	CLIP-seq
MIRT1359010	hsa-miR-4644	CLIP-seq
MIRT1359011	hsa-miR-4690-3p	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003044	Process	Regulation of systemic arterial blood pressure mediated by a chemical signal	IEA
GO:0003044	Process	Regulation of systemic arterial blood pressure mediated by a chemical signal	ISS
GO:0005353	Function	Fructose transmembrane transporter activity	IBA
GO:0005353	Function	Fructose transmembrane transporter activity	IDA	8333543, 28083649, 29548810
GO:0005353	Function	Fructose transmembrane transporter activity	IEA
GO:0005353	Function	Fructose transmembrane transporter activity	TAS	1634504
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	8333543, 28083649
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS	1634504
GO:0005975	Process	Carbohydrate metabolic process	TAS	1634504
GO:0009750	Process	Response to fructose	IEA
GO:0009750	Process	Response to fructose	ISS
GO:0015755	Process	Fructose transmembrane transport	IBA
GO:0015755	Process	Fructose transmembrane transport	IDA	28083649, 29548810
GO:0015755	Process	Fructose transmembrane transport	IEA
GO:0015755	Process	Fructose transmembrane transport	TAS	1634504
GO:0016020	Component	Membrane	IEA
GO:0016324	Component	Apical plasma membrane	IEA
GO:0016324	Component	Apical plasma membrane	ISS
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0035579	Component	Specific granule membrane	TAS
GO:0042383	Component	Sarcolemma	IEA
GO:0042383	Component	Sarcolemma	ISS
GO:0046323	Process	D-glucose import	IBA
GO:0055056	Function	D-glucose transmembrane transporter activity	IBA
GO:0055056	Function	D-glucose transmembrane transporter activity	TAS	1695905
GO:0055085	Process	Transmembrane transport	IEA
GO:0070061	Function	Fructose binding	ISS
GO:0070062	Component	Extracellular exosome	HDA	19056867, 23533145
GO:0070837	Process	Dehydroascorbic acid transport	IBA
GO:0071332	Process	Cellular response to fructose stimulus	IEA
GO:0071332	Process	Cellular response to fructose stimulus	ISS
GO:0106001	Process	Intestinal hexose absorption	TAS
GO:1904659	Process	D-glucose transmembrane transport	TAS	1695905
GO:1990539	Process	Fructose import across plasma membrane	IDA	8333543
GO:1990539	Process	Fructose import across plasma membrane	IEA

MIM	HGNC	e!Ensembl
138230	11010	ENSG00000142583

P22732

Protein name

Solute carrier family 2, facilitated glucose transporter member 5 (Fructose transporter) (Glucose transporter type 5, small intestine) (GLUT-5)

Protein function

Functions as a fructose transporter that has only low activity with other monosaccharides (PubMed:16186102, PubMed:17710649, PubMed:28083649, PubMed:29548810, PubMed:8333543). Can mediate the uptake of 2-deoxyglucose, but with low efficiency (Pu

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00083	Sugar_tr	20 → 475	Sugar (and other) transporter	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in skeletal muscle, and in jejunum brush border membrane and basolateral membrane (at protein level) (PubMed:7619085). Expressed in small intestine, and at much lower levels in kidney, skeletal muscle, and adipose tissue. {ECO

Sequence

MEQQDQSMKEGRLTLVLALATLIAAFGSSFQYGYNVAAVNSPALLMQQFYNETYYGRTGE
FMEDFPLTLLWSVTVSMFPFGGFIGSLLVGPLVNKFGRKGALLFNNIFSIVPAILMGCSR
VATSFELIIISRLLVGICAGVSSNVVPMYLGELAPKNLRGALGVVPQLFITVGILVAQIF
GLRNLLANVDGWPILLGLTGVPAALQLLLLPFFPESPRYLLIQKKDEAAAKKALQTLRGW
DSVDREVAEIRQEDEAEKAAGFISVLKLFRMRSLRWQLLSIIVLMGGQQLSGVNAIYYYA
DQIYLSAGVPEEHVQYVTAGTGAVNVVMTFCAVFVVELLGRRLLLLLGFSICLIACCVLT
AALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLITEIFLQSSRPSAFMVGGSVHW
LSNFTVGLIFPFIQEGLGPYSFIVFAVICLLTTIYIFLIVPETKAKTFIEINQIFTKMNK
VSEVYPEKEELKELPPVTSEQ

Sequence length

501

Interactions

View interactions

	KEGG		Reactome
	Carbohydrate digestion and absorption		Neutrophil degranulation Intestinal hexose absorption

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Long QT syndrome	association	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)

Show/Hide Text Mining Associations (59)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	16523487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25326153		★★★★★ ★☆☆☆☆ Found in Text Mining only
B Acute Lymphoblastic Leukemia with t(9;22)(q34.1;q11.2); BCR-ABL1	Lymphoblastic Leukemia	BEFREE	30272826		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15449313, 16523487, 19586773, 22073218, 28371343, 29142019, 29913554, 30550258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	15449313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27074918, 29642606, 34064801, 38019251, 8700847	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinogenesis	Carcinogenesis	Pubtator	35813468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37738413	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	31371983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23341889	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	30373325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34052986	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31102011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	11804845	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	27074918, 28740135, 37062501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	11804845	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11804845, 31243309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	36245009	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29660339		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	19091748, 21143427, 23129794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	17658463	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33679749	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	25029475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29467549		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33159578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Atresia	Intestinal Atresia	BEFREE	31261244		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31918632	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	27746145		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	15449313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	15449313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Long QT Syndrome	Long QT Syndrome	CLINVAR_DG			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lung Neoplasms	Lung Neoplasms	BEFREE	10622535		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malabsorption Syndrome	Malabsorption Syndrome	BEFREE	19091748, 21148401, 23129794, 29669261, 8941659		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15449313, 16523487, 19586773, 22073218, 28371343, 29142019, 29642606, 29913554, 30550258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	15449313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	31371983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21938742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28346751, 29642606, 29660339, 31102011, 31243309, 31371983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	30373325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	15449313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15449313, 16523487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	15449313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	15449313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30113044, 31243309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	28740135	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21143427		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	17044048, 29142019, 29660339, 31371983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17044048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30373325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28936585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	37062501	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	31371983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37087023	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Thecoma	Ovarian Thecoma	BEFREE	27987341		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21938742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	34001952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16523487		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	23440187	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31553933		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC2A5 (solute carrier family 2 member 5)