Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	65125
Gene name	WNK lysine deficient protein kinase 1
Gene symbol	WNK1
Synonyms (NCBI Gene)	HSAN2HSN2KDPPPP1R167PRKWNK1PSKp65
Chromosome	12
Chromosome location	12p13.33
Summary	This gene encodes a member of the WNK subfamily of serine/threonine protein kinases. The encoded protein may be a key regulator of blood pressure by controlling the transport of sodium and chloride ions. Mutations in this gene have been associated with ps

Show/Hide all (22)

SNP ID	Visualize variation	Clinical significance	Consequence
rs72648621	C>T	Likely-benign, conflicting-interpretations-of-pathogenicity	Genic upstream transcript variant, synonymous variant, coding sequence variant
rs72649848	C>T	Conflicting-interpretations-of-pathogenicity	Missense variant, intron variant, coding sequence variant
rs72650720	G>A	Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity	Missense variant, coding sequence variant
rs72650740	G>A	Likely-benign, conflicting-interpretations-of-pathogenicity	Intron variant
rs111033590	C>T	Pathogenic	Coding sequence variant, intron variant, stop gained
rs111033591	C>T	Pathogenic	Coding sequence variant, intron variant, stop gained
rs111033592	C>T	Pathogenic	Coding sequence variant, intron variant, stop gained
rs137852734	A>-	Pathogenic	Frameshift variant, coding sequence variant, intron variant
rs137852735	->A	Pathogenic	Frameshift variant, coding sequence variant, intron variant
rs142543401	A>C,G,T	Conflicting-interpretations-of-pathogenicity, likely-benign	Missense variant, coding sequence variant
rs149852592	T>C	Likely-benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs151331381	T>C	Likely-benign, conflicting-interpretations-of-pathogenicity	Synonymous variant, coding sequence variant
rs387906331	G>-	Pathogenic	Intron variant, coding sequence variant, frameshift variant
rs387906332	GA>-	Pathogenic	Frameshift variant, coding sequence variant
rs544395150	ACTAGTTCA>-	Likely-benign, conflicting-interpretations-of-pathogenicity	Coding sequence variant, inframe deletion
rs786205473	C>G,T	Likely-pathogenic, uncertain-significance	Intron variant, missense variant, coding sequence variant
rs879254311	C>T	Likely-pathogenic	Coding sequence variant, intron variant, stop gained
rs910119961	->T	Pathogenic	Intron variant, frameshift variant, coding sequence variant
rs1051081383	C>T	Pathogenic	Stop gained, coding sequence variant
rs1478989689	C>T	Pathogenic	Stop gained, coding sequence variant, intron variant
rs1592095957	G>A	Pathogenic	Stop gained, intron variant, coding sequence variant
rs1592141343	->CTTTCACA	Pathogenic	Frameshift variant, coding sequence variant

904

Show/Hide all (904)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005582	hsa-miR-192-5p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	20813867
MIRT005583	hsa-miR-215-5p	Luciferase reporter assayNorthern blotqRT-PCRWestern blot	20813867
MIRT030974	hsa-miR-21-5p	Microarray	18591254
MIRT052359	hsa-let-7b-5p	CLASH	23622248
MIRT048089	hsa-miR-197-3p	CLASH	23622248
MIRT048089	hsa-miR-197-3p	CLASH	23622248
MIRT047108	hsa-miR-183-5p	CLASH	23622248
MIRT046056	hsa-miR-125b-5p	CLASH	23622248
MIRT046056	hsa-miR-125b-5p	CLASH	23622248
MIRT045660	hsa-miR-149-5p	CLASH	23622248
MIRT045005	hsa-miR-186-5p	CLASH	23622248
MIRT045005	hsa-miR-186-5p	CLASH	23622248
MIRT044712	hsa-miR-320a	CLASH	23622248
MIRT043954	hsa-miR-378a-3p	CLASH	23622248
MIRT043274	hsa-miR-331-3p	CLASH	23622248
MIRT042524	hsa-miR-423-3p	CLASH	23622248
MIRT041474	hsa-miR-193b-3p	CLASH	23622248
MIRT040788	hsa-miR-18a-3p	CLASH	23622248
MIRT040788	hsa-miR-18a-3p	CLASH	23622248
MIRT040135	hsa-miR-615-3p	CLASH	23622248
MIRT038785	hsa-miR-93-3p	CLASH	23622248
MIRT038570	hsa-miR-106b-3p	CLASH	23622248
MIRT037785	hsa-miR-550a-5p	CLASH	23622248
MIRT037011	hsa-miR-877-3p	CLASH	23622248
MIRT132936	hsa-miR-155-5p	MicroarrayqRT-PCR	22815788
MIRT132931	hsa-miR-27a-3p	MicroarrayqRT-PCR	22815788
MIRT132933	hsa-miR-27b-3p	MicroarrayqRT-PCR	22815788
MIRT438173	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	24299514
MIRT438173	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	24299514
MIRT438173	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	24299514
MIRT438173	hsa-miR-199a-5p	Luciferase reporter assayqRT-PCRWestern blot	24299514
MIRT697670	hsa-miR-7-1-3p	HITS-CLIP	23313552
MIRT697669	hsa-miR-7-2-3p	HITS-CLIP	23313552
MIRT697668	hsa-miR-944	HITS-CLIP	23313552
MIRT697667	hsa-miR-126-5p	HITS-CLIP	23313552
MIRT697666	hsa-miR-8063	HITS-CLIP	23313552
MIRT697665	hsa-miR-181a-2-3p	HITS-CLIP	23313552
MIRT697664	hsa-miR-1273g-3p	HITS-CLIP	23313552
MIRT697663	hsa-miR-6764-3p	HITS-CLIP	23313552
MIRT697662	hsa-miR-6824-3p	HITS-CLIP	23313552
MIRT697661	hsa-miR-4490	HITS-CLIP	23313552
MIRT697660	hsa-miR-4774-5p	HITS-CLIP	23313552
MIRT697659	hsa-miR-3975	HITS-CLIP	23313552
MIRT697658	hsa-miR-2467-5p	HITS-CLIP	23313552
MIRT697657	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT697656	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT697655	hsa-miR-3188	HITS-CLIP	23313552
MIRT697654	hsa-miR-6076	HITS-CLIP	23313552
MIRT697653	hsa-miR-6797-3p	HITS-CLIP	23313552
MIRT697652	hsa-miR-4268	HITS-CLIP	23313552
MIRT697651	hsa-miR-4448	HITS-CLIP	23313552
MIRT697650	hsa-miR-4477a	HITS-CLIP	23313552
MIRT697649	hsa-miR-4795-3p	HITS-CLIP	23313552
MIRT697648	hsa-miR-6509-3p	HITS-CLIP	23313552
MIRT697647	hsa-miR-6780a-3p	HITS-CLIP	23313552
MIRT697646	hsa-miR-6772-3p	HITS-CLIP	23313552
MIRT651545	hsa-miR-4700-3p	HITS-CLIP	23824327
MIRT651544	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT651543	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT651542	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT651541	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT651540	hsa-miR-7114-5p	HITS-CLIP	23824327
MIRT651539	hsa-miR-134-3p	HITS-CLIP	23824327
MIRT651538	hsa-miR-2114-3p	HITS-CLIP	23824327
MIRT651537	hsa-miR-6823-3p	HITS-CLIP	23824327
MIRT651535	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT651536	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT651534	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT651533	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT651532	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT651531	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT132955	hsa-miR-302f	HITS-CLIP	23824327
MIRT062184	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT132970	hsa-miR-4775	HITS-CLIP	23824327
MIRT132966	hsa-miR-4639-5p	HITS-CLIP	23824327
MIRT621597	hsa-miR-384	HITS-CLIP	23824327
MIRT132955	hsa-miR-302f	HITS-CLIP	23824327
MIRT062184	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT132970	hsa-miR-4775	HITS-CLIP	23824327
MIRT132966	hsa-miR-4639-5p	HITS-CLIP	23824327
MIRT621597	hsa-miR-384	HITS-CLIP	23824327
MIRT132955	hsa-miR-302f	HITS-CLIP	23824327
MIRT062184	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT132970	hsa-miR-4775	HITS-CLIP	23824327
MIRT132966	hsa-miR-4639-5p	HITS-CLIP	23824327
MIRT636141	hsa-miR-3685	HITS-CLIP	23824327
MIRT621597	hsa-miR-384	HITS-CLIP	23824327
MIRT132955	hsa-miR-302f	HITS-CLIP	23824327
MIRT062184	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT132970	hsa-miR-4775	HITS-CLIP	23824327
MIRT132966	hsa-miR-4639-5p	HITS-CLIP	23824327
MIRT621597	hsa-miR-384	HITS-CLIP	23824327
MIRT062179	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT062192	hsa-miR-7849-3p	PAR-CLIP	20371350
MIRT564994	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT564997	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT062185	hsa-miR-300	PAR-CLIP	20371350
MIRT062181	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT062188	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT564995	hsa-miR-4272	PAR-CLIP	20371350
MIRT564996	hsa-miR-5697	PAR-CLIP	20371350
MIRT564994	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT062174	hsa-let-7a-3p	PAR-CLIP	20371350
MIRT062175	hsa-let-7b-3p	PAR-CLIP	20371350
MIRT062176	hsa-let-7f-1-3p	PAR-CLIP	20371350
MIRT062180	hsa-miR-98-3p	PAR-CLIP	20371350
MIRT564992	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT564993	hsa-let-7f-2-3p	PAR-CLIP	20371350
MIRT564991	hsa-miR-1185-1-3p	PAR-CLIP	20371350
MIRT564990	hsa-miR-1185-2-3p	PAR-CLIP	20371350
MIRT062186	hsa-miR-1297	PAR-CLIP	20371350
MIRT062177	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT062178	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT062187	hsa-miR-4465	PAR-CLIP	20371350
MIRT132942	hsa-miR-548a-3p	PAR-CLIP	22012620
MIRT132971	hsa-miR-548ar-3p	PAR-CLIP	22012620
MIRT132972	hsa-miR-548az-3p	PAR-CLIP	22012620
MIRT132951	hsa-miR-548e-3p	PAR-CLIP	22012620
MIRT132952	hsa-miR-548f-3p	PAR-CLIP	22012620
MIRT533162	hsa-miR-5582-3p	PAR-CLIP	22012620
MIRT132943	hsa-miR-606	PAR-CLIP	22012620
MIRT533161	hsa-miR-452-5p	PAR-CLIP	22012620
MIRT533160	hsa-miR-4676-3p	PAR-CLIP	22012620
MIRT533159	hsa-miR-892c-3p	PAR-CLIP	22012620
MIRT533158	hsa-miR-1279	PAR-CLIP	22012620
MIRT533157	hsa-miR-302a-5p	PAR-CLIP	22012620
MIRT533156	hsa-miR-6755-3p	PAR-CLIP	22012620
MIRT533155	hsa-miR-5007-3p	PAR-CLIP	22012620
MIRT132981	hsa-miR-19a-3p	HITS-CLIP	22473208
MIRT132982	hsa-miR-19b-3p	HITS-CLIP	22473208
MIRT132931	hsa-miR-27a-3p	HITS-CLIP	22473208
MIRT132933	hsa-miR-27b-3p	HITS-CLIP	22473208
MIRT048089	hsa-miR-197-3p	qRT-PCR	28178938
MIRT132931	hsa-miR-27a-3p	Luciferase reporter assay	26378023
MIRT132931	hsa-miR-27a-3p	Luciferase reporter assay	26378023
MIRT697670	hsa-miR-7-1-3p	HITS-CLIP	23313552
MIRT697669	hsa-miR-7-2-3p	HITS-CLIP	23313552
MIRT697668	hsa-miR-944	HITS-CLIP	23313552
MIRT697667	hsa-miR-126-5p	HITS-CLIP	23313552
MIRT697666	hsa-miR-8063	HITS-CLIP	23313552
MIRT697665	hsa-miR-181a-2-3p	HITS-CLIP	23313552
MIRT697664	hsa-miR-1273g-3p	HITS-CLIP	23313552
MIRT697663	hsa-miR-6764-3p	HITS-CLIP	23313552
MIRT697662	hsa-miR-6824-3p	HITS-CLIP	23313552
MIRT697661	hsa-miR-4490	HITS-CLIP	23313552
MIRT697660	hsa-miR-4774-5p	HITS-CLIP	23313552
MIRT697659	hsa-miR-3975	HITS-CLIP	23313552
MIRT697658	hsa-miR-2467-5p	HITS-CLIP	23313552
MIRT697657	hsa-miR-485-5p	HITS-CLIP	23313552
MIRT697656	hsa-miR-6884-5p	HITS-CLIP	23313552
MIRT697655	hsa-miR-3188	HITS-CLIP	23313552
MIRT697654	hsa-miR-6076	HITS-CLIP	23313552
MIRT697653	hsa-miR-6797-3p	HITS-CLIP	23313552
MIRT697652	hsa-miR-4268	HITS-CLIP	23313552
MIRT697651	hsa-miR-4448	HITS-CLIP	23313552
MIRT697650	hsa-miR-4477a	HITS-CLIP	23313552
MIRT697649	hsa-miR-4795-3p	HITS-CLIP	23313552
MIRT697648	hsa-miR-6509-3p	HITS-CLIP	23313552
MIRT697647	hsa-miR-6780a-3p	HITS-CLIP	23313552
MIRT697646	hsa-miR-6772-3p	HITS-CLIP	23313552
MIRT651545	hsa-miR-4700-3p	HITS-CLIP	23824327
MIRT651544	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT651543	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT651542	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT651541	hsa-miR-130b-5p	HITS-CLIP	23824327
MIRT651540	hsa-miR-7114-5p	HITS-CLIP	23824327
MIRT651539	hsa-miR-134-3p	HITS-CLIP	23824327
MIRT651538	hsa-miR-2114-3p	HITS-CLIP	23824327
MIRT651537	hsa-miR-6823-3p	HITS-CLIP	23824327
MIRT651535	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT651536	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT651534	hsa-miR-6512-3p	HITS-CLIP	23824327
MIRT651533	hsa-miR-6720-5p	HITS-CLIP	23824327
MIRT651532	hsa-miR-4743-3p	HITS-CLIP	23824327
MIRT651531	hsa-miR-4652-3p	HITS-CLIP	23824327
MIRT132955	hsa-miR-302f	HITS-CLIP	23824327
MIRT062184	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT132970	hsa-miR-4775	HITS-CLIP	23824327
MIRT132966	hsa-miR-4639-5p	HITS-CLIP	23824327
MIRT621597	hsa-miR-384	HITS-CLIP	23824327
MIRT132955	hsa-miR-302f	HITS-CLIP	23824327
MIRT062184	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT132970	hsa-miR-4775	HITS-CLIP	23824327
MIRT132966	hsa-miR-4639-5p	HITS-CLIP	23824327
MIRT621597	hsa-miR-384	HITS-CLIP	23824327
MIRT132955	hsa-miR-302f	HITS-CLIP	23824327
MIRT062184	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT132970	hsa-miR-4775	HITS-CLIP	23824327
MIRT132966	hsa-miR-4639-5p	HITS-CLIP	23824327
MIRT636141	hsa-miR-3685	HITS-CLIP	23824327
MIRT621597	hsa-miR-384	HITS-CLIP	23824327
MIRT132955	hsa-miR-302f	HITS-CLIP	23824327
MIRT062184	hsa-miR-590-3p	HITS-CLIP	23824327
MIRT132970	hsa-miR-4775	HITS-CLIP	23824327
MIRT132966	hsa-miR-4639-5p	HITS-CLIP	23824327
MIRT621597	hsa-miR-384	HITS-CLIP	23824327
MIRT062179	hsa-miR-32-3p	PAR-CLIP	20371350
MIRT062192	hsa-miR-7849-3p	PAR-CLIP	20371350
MIRT564994	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT564997	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT062185	hsa-miR-300	PAR-CLIP	20371350
MIRT062181	hsa-miR-381-3p	PAR-CLIP	20371350
MIRT062188	hsa-miR-4666a-3p	PAR-CLIP	20371350
MIRT564995	hsa-miR-4272	PAR-CLIP	20371350
MIRT564996	hsa-miR-5697	PAR-CLIP	20371350
MIRT564994	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT062174	hsa-let-7a-3p	PAR-CLIP	20371350
MIRT062175	hsa-let-7b-3p	PAR-CLIP	20371350
MIRT062176	hsa-let-7f-1-3p	PAR-CLIP	20371350
MIRT062180	hsa-miR-98-3p	PAR-CLIP	20371350
MIRT564992	hsa-miR-4789-5p	PAR-CLIP	20371350
MIRT564993	hsa-let-7f-2-3p	PAR-CLIP	20371350
MIRT564991	hsa-miR-1185-1-3p	PAR-CLIP	20371350
MIRT564990	hsa-miR-1185-2-3p	PAR-CLIP	20371350
MIRT062186	hsa-miR-1297	PAR-CLIP	20371350
MIRT062177	hsa-miR-26a-5p	PAR-CLIP	20371350
MIRT062178	hsa-miR-26b-5p	PAR-CLIP	20371350
MIRT062187	hsa-miR-4465	PAR-CLIP	20371350
MIRT132942	hsa-miR-548a-3p	PAR-CLIP	22012620
MIRT132971	hsa-miR-548ar-3p	PAR-CLIP	22012620
MIRT132972	hsa-miR-548az-3p	PAR-CLIP	22012620
MIRT132951	hsa-miR-548e-3p	PAR-CLIP	22012620
MIRT132952	hsa-miR-548f-3p	PAR-CLIP	22012620
MIRT533162	hsa-miR-5582-3p	PAR-CLIP	22012620
MIRT132943	hsa-miR-606	PAR-CLIP	22012620
MIRT533161	hsa-miR-452-5p	PAR-CLIP	22012620
MIRT533160	hsa-miR-4676-3p	PAR-CLIP	22012620
MIRT533159	hsa-miR-892c-3p	PAR-CLIP	22012620
MIRT533158	hsa-miR-1279	PAR-CLIP	22012620
MIRT533157	hsa-miR-302a-5p	PAR-CLIP	22012620
MIRT533156	hsa-miR-6755-3p	PAR-CLIP	22012620
MIRT533155	hsa-miR-5007-3p	PAR-CLIP	22012620
MIRT1493276	hsa-miR-101	CLIP-seq
MIRT1493277	hsa-miR-103a	CLIP-seq
MIRT1493278	hsa-miR-106a	CLIP-seq
MIRT1493279	hsa-miR-106b	CLIP-seq
MIRT1493280	hsa-miR-107	CLIP-seq
MIRT1493281	hsa-miR-10a	CLIP-seq
MIRT1493282	hsa-miR-10b	CLIP-seq
MIRT1493283	hsa-miR-1224-3p	CLIP-seq
MIRT1493284	hsa-miR-1244	CLIP-seq
MIRT1493285	hsa-miR-1260	CLIP-seq
MIRT1493286	hsa-miR-1260b	CLIP-seq
MIRT1493287	hsa-miR-1264	CLIP-seq
MIRT1493288	hsa-miR-1276	CLIP-seq
MIRT1493289	hsa-miR-128	CLIP-seq
MIRT1493290	hsa-miR-1280	CLIP-seq
MIRT1493291	hsa-miR-1283	CLIP-seq
MIRT1493292	hsa-miR-129-5p	CLIP-seq
MIRT1493293	hsa-miR-130a	CLIP-seq
MIRT1493294	hsa-miR-130b	CLIP-seq
MIRT1493295	hsa-miR-1323	CLIP-seq
MIRT1493296	hsa-miR-141	CLIP-seq
MIRT1493297	hsa-miR-144	CLIP-seq
MIRT1493298	hsa-miR-17	CLIP-seq
MIRT1493299	hsa-miR-181a	CLIP-seq
MIRT1493300	hsa-miR-181b	CLIP-seq
MIRT1493301	hsa-miR-181c	CLIP-seq
MIRT1493302	hsa-miR-181d	CLIP-seq
MIRT1493303	hsa-miR-188-3p	CLIP-seq
MIRT1493304	hsa-miR-1912	CLIP-seq
MIRT1493305	hsa-miR-192	CLIP-seq
MIRT1493306	hsa-miR-198	CLIP-seq
MIRT1493307	hsa-miR-19a	CLIP-seq
MIRT1493308	hsa-miR-19b	CLIP-seq
MIRT1493309	hsa-miR-200a	CLIP-seq
MIRT1493310	hsa-miR-20a	CLIP-seq
MIRT1493311	hsa-miR-20b	CLIP-seq
MIRT1493312	hsa-miR-215	CLIP-seq
MIRT1493313	hsa-miR-23a	CLIP-seq
MIRT1493314	hsa-miR-23b	CLIP-seq
MIRT1493315	hsa-miR-23c	CLIP-seq
MIRT1493316	hsa-miR-26a	CLIP-seq
MIRT1493317	hsa-miR-26b	CLIP-seq
MIRT1493318	hsa-miR-27a	CLIP-seq
MIRT1493319	hsa-miR-27b	CLIP-seq
MIRT1493320	hsa-miR-301a	CLIP-seq
MIRT1493321	hsa-miR-301b	CLIP-seq
MIRT1493322	hsa-miR-3074-3p	CLIP-seq
MIRT1493323	hsa-miR-3148	CLIP-seq
MIRT1493324	hsa-miR-3153	CLIP-seq
MIRT1493325	hsa-miR-3156-3p	CLIP-seq
MIRT1493326	hsa-miR-3173-3p	CLIP-seq
MIRT1493327	hsa-miR-325	CLIP-seq
MIRT1493328	hsa-miR-337-5p	CLIP-seq
MIRT1493329	hsa-miR-338-3p	CLIP-seq
MIRT1493330	hsa-miR-3609	CLIP-seq
MIRT1493331	hsa-miR-3612	CLIP-seq
MIRT1493332	hsa-miR-3613-5p	CLIP-seq
MIRT1493333	hsa-miR-3618	CLIP-seq
MIRT1493334	hsa-miR-3666	CLIP-seq
MIRT1493335	hsa-miR-3682-5p	CLIP-seq
MIRT1493336	hsa-miR-3688-3p	CLIP-seq
MIRT1493337	hsa-miR-3692	CLIP-seq
MIRT1493338	hsa-miR-374c	CLIP-seq
MIRT1493339	hsa-miR-381	CLIP-seq
MIRT1493340	hsa-miR-3913-3p	CLIP-seq
MIRT1493341	hsa-miR-3923	CLIP-seq
MIRT1493342	hsa-miR-4251	CLIP-seq
MIRT1493343	hsa-miR-4261	CLIP-seq
MIRT1493344	hsa-miR-4262	CLIP-seq
MIRT1493345	hsa-miR-4295	CLIP-seq
MIRT1493346	hsa-miR-4311	CLIP-seq
MIRT1493347	hsa-miR-4420	CLIP-seq
MIRT1493348	hsa-miR-4422	CLIP-seq
MIRT1493349	hsa-miR-4427	CLIP-seq
MIRT1493350	hsa-miR-4452	CLIP-seq
MIRT1493351	hsa-miR-4470	CLIP-seq
MIRT1493352	hsa-miR-4473	CLIP-seq
MIRT1493353	hsa-miR-4485	CLIP-seq
MIRT1493354	hsa-miR-4509	CLIP-seq
MIRT1493355	hsa-miR-452	CLIP-seq
MIRT1493356	hsa-miR-4520a-3p	CLIP-seq
MIRT1493357	hsa-miR-4520b-3p	CLIP-seq
MIRT1493358	hsa-miR-4529-3p	CLIP-seq
MIRT1493359	hsa-miR-4530	CLIP-seq
MIRT1493360	hsa-miR-454	CLIP-seq
MIRT1493361	hsa-miR-4646-5p	CLIP-seq
MIRT1493362	hsa-miR-4663	CLIP-seq
MIRT1493363	hsa-miR-4666-3p	CLIP-seq
MIRT1493364	hsa-miR-4666-5p	CLIP-seq
MIRT1493365	hsa-miR-4668-5p	CLIP-seq
MIRT1493366	hsa-miR-4671-3p	CLIP-seq
MIRT1493367	hsa-miR-4695-5p	CLIP-seq
MIRT1493368	hsa-miR-4698	CLIP-seq
MIRT1493369	hsa-miR-4712-5p	CLIP-seq
MIRT1493370	hsa-miR-4720-3p	CLIP-seq
MIRT1493371	hsa-miR-4729	CLIP-seq
MIRT1493372	hsa-miR-4744	CLIP-seq
MIRT1493373	hsa-miR-4772-3p	CLIP-seq
MIRT1493374	hsa-miR-4777-5p	CLIP-seq
MIRT1493375	hsa-miR-4796-3p	CLIP-seq
MIRT1493376	hsa-miR-4799-5p	CLIP-seq
MIRT1493377	hsa-miR-4804-3p	CLIP-seq
MIRT1493378	hsa-miR-487a	CLIP-seq
MIRT1493379	hsa-miR-495	CLIP-seq
MIRT1493380	hsa-miR-509-3p	CLIP-seq
MIRT1493381	hsa-miR-5096	CLIP-seq
MIRT1493382	hsa-miR-518a-3p	CLIP-seq
MIRT1493383	hsa-miR-518b	CLIP-seq
MIRT1493384	hsa-miR-518c	CLIP-seq
MIRT1493385	hsa-miR-518d-3p	CLIP-seq
MIRT1493386	hsa-miR-518d-5p	CLIP-seq
MIRT1493387	hsa-miR-518f	CLIP-seq
MIRT1493388	hsa-miR-519b-5p	CLIP-seq
MIRT1493389	hsa-miR-519c-5p	CLIP-seq
MIRT1493390	hsa-miR-519d	CLIP-seq
MIRT1493391	hsa-miR-520c-5p	CLIP-seq
MIRT1493392	hsa-miR-520d-5p	CLIP-seq
MIRT1493393	hsa-miR-524-5p	CLIP-seq
MIRT1493394	hsa-miR-526a	CLIP-seq
MIRT1493395	hsa-miR-539	CLIP-seq
MIRT1493396	hsa-miR-548ag	CLIP-seq
MIRT1493397	hsa-miR-548ah	CLIP-seq
MIRT1493398	hsa-miR-548ai	CLIP-seq
MIRT1493399	hsa-miR-548e	CLIP-seq
MIRT1493400	hsa-miR-548f	CLIP-seq
MIRT1493401	hsa-miR-548m	CLIP-seq
MIRT1493402	hsa-miR-548o	CLIP-seq
MIRT1493403	hsa-miR-561	CLIP-seq
MIRT1493404	hsa-miR-583	CLIP-seq
MIRT1493405	hsa-miR-600	CLIP-seq
MIRT1493406	hsa-miR-650	CLIP-seq
MIRT1493407	hsa-miR-655	CLIP-seq
MIRT1493408	hsa-miR-770-5p	CLIP-seq
MIRT1493409	hsa-miR-93	CLIP-seq
MIRT1493410	hsa-miR-136	CLIP-seq
MIRT1493296	hsa-miR-141	CLIP-seq
MIRT1493309	hsa-miR-200a	CLIP-seq
MIRT1493323	hsa-miR-3148	CLIP-seq
MIRT1493411	hsa-miR-3175	CLIP-seq
MIRT1493412	hsa-miR-3190	CLIP-seq
MIRT1493413	hsa-miR-323b-3p	CLIP-seq
MIRT1493414	hsa-miR-3616-3p	CLIP-seq
MIRT1493415	hsa-miR-374a	CLIP-seq
MIRT1493416	hsa-miR-374b	CLIP-seq
MIRT1493417	hsa-miR-3973	CLIP-seq
MIRT1493418	hsa-miR-4303	CLIP-seq
MIRT1493419	hsa-miR-4437	CLIP-seq
MIRT1493420	hsa-miR-4491	CLIP-seq
MIRT1493421	hsa-miR-4649-3p	CLIP-seq
MIRT1493422	hsa-miR-4657	CLIP-seq
MIRT1493423	hsa-miR-4714-3p	CLIP-seq
MIRT1493424	hsa-miR-4721	CLIP-seq
MIRT1493425	hsa-miR-4723-5p	CLIP-seq
MIRT1493371	hsa-miR-4729	CLIP-seq
MIRT1493426	hsa-miR-4760-3p	CLIP-seq
MIRT1493427	hsa-miR-4781-5p	CLIP-seq
MIRT1493428	hsa-miR-496	CLIP-seq
MIRT1493380	hsa-miR-509-3p	CLIP-seq
MIRT1493429	hsa-miR-520g	CLIP-seq
MIRT1493430	hsa-miR-520h	CLIP-seq
MIRT1493431	hsa-miR-548ac	CLIP-seq
MIRT1493432	hsa-miR-548ae	CLIP-seq
MIRT1493433	hsa-miR-548aj	CLIP-seq
MIRT1493434	hsa-miR-548am	CLIP-seq
MIRT1493435	hsa-miR-548d-3p	CLIP-seq
MIRT1493436	hsa-miR-548x	CLIP-seq
MIRT1493437	hsa-miR-548z	CLIP-seq
MIRT1493438	hsa-miR-556-3p	CLIP-seq
MIRT1493403	hsa-miR-561	CLIP-seq
MIRT1493439	hsa-miR-582-3p	CLIP-seq
MIRT1493440	hsa-miR-629	CLIP-seq
MIRT1493441	hsa-miR-888	CLIP-seq
MIRT1493289	hsa-miR-128	CLIP-seq
MIRT1493295	hsa-miR-1323	CLIP-seq
MIRT1493318	hsa-miR-27a	CLIP-seq
MIRT1493319	hsa-miR-27b	CLIP-seq
MIRT1493337	hsa-miR-3692	CLIP-seq
MIRT1493351	hsa-miR-4470	CLIP-seq
MIRT1493364	hsa-miR-4666-5p	CLIP-seq
MIRT1493399	hsa-miR-548e	CLIP-seq
MIRT1493400	hsa-miR-548f	CLIP-seq
MIRT1493402	hsa-miR-548o	CLIP-seq
MIRT1493276	hsa-miR-101	CLIP-seq
MIRT2148722	hsa-miR-1179	CLIP-seq
MIRT2148723	hsa-miR-1262	CLIP-seq
MIRT2148724	hsa-miR-127-5p	CLIP-seq
MIRT1493289	hsa-miR-128	CLIP-seq
MIRT2148725	hsa-miR-1293	CLIP-seq
MIRT1493293	hsa-miR-130a	CLIP-seq
MIRT1493294	hsa-miR-130b	CLIP-seq
MIRT1493295	hsa-miR-1323	CLIP-seq
MIRT1493296	hsa-miR-141	CLIP-seq
MIRT1493297	hsa-miR-144	CLIP-seq
MIRT1493299	hsa-miR-181a	CLIP-seq
MIRT1493300	hsa-miR-181b	CLIP-seq
MIRT1493301	hsa-miR-181c	CLIP-seq
MIRT1493302	hsa-miR-181d	CLIP-seq
MIRT1493304	hsa-miR-1912	CLIP-seq
MIRT2148726	hsa-miR-1913	CLIP-seq
MIRT1493306	hsa-miR-198	CLIP-seq
MIRT1493307	hsa-miR-19a	CLIP-seq
MIRT1493308	hsa-miR-19b	CLIP-seq
MIRT1493309	hsa-miR-200a	CLIP-seq
MIRT2148727	hsa-miR-22	CLIP-seq
MIRT1493313	hsa-miR-23a	CLIP-seq
MIRT1493314	hsa-miR-23b	CLIP-seq
MIRT1493315	hsa-miR-23c	CLIP-seq
MIRT1493316	hsa-miR-26a	CLIP-seq
MIRT1493317	hsa-miR-26b	CLIP-seq
MIRT1493318	hsa-miR-27a	CLIP-seq
MIRT1493319	hsa-miR-27b	CLIP-seq
MIRT2148728	hsa-miR-298	CLIP-seq
MIRT1493320	hsa-miR-301a	CLIP-seq
MIRT1493321	hsa-miR-301b	CLIP-seq
MIRT1493322	hsa-miR-3074-3p	CLIP-seq
MIRT2148729	hsa-miR-31	CLIP-seq
MIRT2148730	hsa-miR-3124-3p	CLIP-seq
MIRT2148731	hsa-miR-3128	CLIP-seq
MIRT1493324	hsa-miR-3153	CLIP-seq
MIRT1493412	hsa-miR-3190	CLIP-seq
MIRT2148732	hsa-miR-320b	CLIP-seq
MIRT2148733	hsa-miR-320c	CLIP-seq
MIRT2148734	hsa-miR-320d	CLIP-seq
MIRT2148735	hsa-miR-324-3p	CLIP-seq
MIRT1493328	hsa-miR-337-5p	CLIP-seq
MIRT1493329	hsa-miR-338-3p	CLIP-seq
MIRT1493332	hsa-miR-3613-5p	CLIP-seq
MIRT1493334	hsa-miR-3666	CLIP-seq
MIRT1493335	hsa-miR-3682-5p	CLIP-seq
MIRT1493337	hsa-miR-3692	CLIP-seq
MIRT1493338	hsa-miR-374c	CLIP-seq
MIRT1493339	hsa-miR-381	CLIP-seq
MIRT2148736	hsa-miR-382	CLIP-seq
MIRT1493340	hsa-miR-3913-3p	CLIP-seq
MIRT2148737	hsa-miR-3942-5p	CLIP-seq
MIRT2148738	hsa-miR-3978	CLIP-seq
MIRT1493342	hsa-miR-4251	CLIP-seq
MIRT1493343	hsa-miR-4261	CLIP-seq
MIRT1493344	hsa-miR-4262	CLIP-seq
MIRT1493345	hsa-miR-4295	CLIP-seq
MIRT1493418	hsa-miR-4303	CLIP-seq
MIRT2148739	hsa-miR-4310	CLIP-seq
MIRT2148740	hsa-miR-4328	CLIP-seq
MIRT2148741	hsa-miR-4329	CLIP-seq
MIRT1493348	hsa-miR-4422	CLIP-seq
MIRT2148742	hsa-miR-4429	CLIP-seq
MIRT1493351	hsa-miR-4470	CLIP-seq
MIRT2148743	hsa-miR-4471	CLIP-seq
MIRT1493352	hsa-miR-4473	CLIP-seq
MIRT2148744	hsa-miR-4483	CLIP-seq
MIRT1493353	hsa-miR-4485	CLIP-seq
MIRT1493356	hsa-miR-4520a-3p	CLIP-seq
MIRT1493357	hsa-miR-4520b-3p	CLIP-seq
MIRT2148745	hsa-miR-4527	CLIP-seq
MIRT1493358	hsa-miR-4529-3p	CLIP-seq
MIRT1493359	hsa-miR-4530	CLIP-seq
MIRT1493360	hsa-miR-454	CLIP-seq
MIRT2148746	hsa-miR-4640-3p	CLIP-seq
MIRT2148747	hsa-miR-4645-3p	CLIP-seq
MIRT1493361	hsa-miR-4646-5p	CLIP-seq
MIRT2148748	hsa-miR-4659a-3p	CLIP-seq
MIRT2148749	hsa-miR-4659b-3p	CLIP-seq
MIRT1493363	hsa-miR-4666-3p	CLIP-seq
MIRT1493364	hsa-miR-4666-5p	CLIP-seq
MIRT2148750	hsa-miR-4667-5p	CLIP-seq
MIRT1493365	hsa-miR-4668-5p	CLIP-seq
MIRT1493366	hsa-miR-4671-3p	CLIP-seq
MIRT1493368	hsa-miR-4698	CLIP-seq
MIRT2148751	hsa-miR-4700-5p	CLIP-seq
MIRT2148752	hsa-miR-4701-3p	CLIP-seq
MIRT2148753	hsa-miR-4703-5p	CLIP-seq
MIRT2148754	hsa-miR-4720-5p	CLIP-seq
MIRT1493371	hsa-miR-4729	CLIP-seq
MIRT2148755	hsa-miR-4753-3p	CLIP-seq
MIRT2148756	hsa-miR-4762-3p	CLIP-seq
MIRT1493373	hsa-miR-4772-3p	CLIP-seq
MIRT1493374	hsa-miR-4777-5p	CLIP-seq
MIRT2148757	hsa-miR-4799-3p	CLIP-seq
MIRT1493379	hsa-miR-495	CLIP-seq
MIRT1493380	hsa-miR-509-3p	CLIP-seq
MIRT1493382	hsa-miR-518a-3p	CLIP-seq
MIRT1493383	hsa-miR-518b	CLIP-seq
MIRT1493384	hsa-miR-518c	CLIP-seq
MIRT1493385	hsa-miR-518d-3p	CLIP-seq
MIRT1493386	hsa-miR-518d-5p	CLIP-seq
MIRT1493387	hsa-miR-518f	CLIP-seq
MIRT1493388	hsa-miR-519b-5p	CLIP-seq
MIRT1493389	hsa-miR-519c-5p	CLIP-seq
MIRT1493391	hsa-miR-520c-5p	CLIP-seq
MIRT1493394	hsa-miR-526a	CLIP-seq
MIRT1493395	hsa-miR-539	CLIP-seq
MIRT2148758	hsa-miR-543	CLIP-seq
MIRT1493399	hsa-miR-548e	CLIP-seq
MIRT1493400	hsa-miR-548f	CLIP-seq
MIRT1493401	hsa-miR-548m	CLIP-seq
MIRT1493402	hsa-miR-548o	CLIP-seq
MIRT1493438	hsa-miR-556-3p	CLIP-seq
MIRT1493405	hsa-miR-600	CLIP-seq
MIRT2148759	hsa-miR-615-5p	CLIP-seq
MIRT2148760	hsa-miR-635	CLIP-seq
MIRT2148761	hsa-miR-637	CLIP-seq
MIRT1493407	hsa-miR-655	CLIP-seq
MIRT2148762	hsa-miR-663b	CLIP-seq
MIRT2148763	hsa-miR-876-3p	CLIP-seq
MIRT2148764	hsa-miR-889	CLIP-seq
MIRT2148765	hsa-miR-938	CLIP-seq
MIRT2148766	hsa-miR-942	CLIP-seq
MIRT1493276	hsa-miR-101	CLIP-seq
MIRT1493277	hsa-miR-103a	CLIP-seq
MIRT1493280	hsa-miR-107	CLIP-seq
MIRT1493281	hsa-miR-10a	CLIP-seq
MIRT1493282	hsa-miR-10b	CLIP-seq
MIRT2369141	hsa-miR-124	CLIP-seq
MIRT1493284	hsa-miR-1244	CLIP-seq
MIRT1493289	hsa-miR-128	CLIP-seq
MIRT2369142	hsa-miR-129-3p	CLIP-seq
MIRT2369143	hsa-miR-1298	CLIP-seq
MIRT1493293	hsa-miR-130a	CLIP-seq
MIRT1493294	hsa-miR-130b	CLIP-seq
MIRT1493295	hsa-miR-1323	CLIP-seq
MIRT1493410	hsa-miR-136	CLIP-seq
MIRT1493296	hsa-miR-141	CLIP-seq
MIRT1493297	hsa-miR-144	CLIP-seq
MIRT1493299	hsa-miR-181a	CLIP-seq
MIRT1493300	hsa-miR-181b	CLIP-seq
MIRT1493301	hsa-miR-181c	CLIP-seq
MIRT1493302	hsa-miR-181d	CLIP-seq
MIRT1493304	hsa-miR-1912	CLIP-seq
MIRT1493306	hsa-miR-198	CLIP-seq
MIRT1493307	hsa-miR-19a	CLIP-seq
MIRT1493308	hsa-miR-19b	CLIP-seq
MIRT1493309	hsa-miR-200a	CLIP-seq
MIRT2369144	hsa-miR-2355-5p	CLIP-seq
MIRT1493313	hsa-miR-23a	CLIP-seq
MIRT1493314	hsa-miR-23b	CLIP-seq
MIRT1493315	hsa-miR-23c	CLIP-seq
MIRT1493316	hsa-miR-26a	CLIP-seq
MIRT1493317	hsa-miR-26b	CLIP-seq
MIRT1493318	hsa-miR-27a	CLIP-seq
MIRT1493319	hsa-miR-27b	CLIP-seq
MIRT1493320	hsa-miR-301a	CLIP-seq
MIRT1493321	hsa-miR-301b	CLIP-seq
MIRT1493322	hsa-miR-3074-3p	CLIP-seq
MIRT2148730	hsa-miR-3124-3p	CLIP-seq
MIRT1493324	hsa-miR-3153	CLIP-seq
MIRT1493326	hsa-miR-3173-3p	CLIP-seq
MIRT1493411	hsa-miR-3175	CLIP-seq
MIRT1493327	hsa-miR-325	CLIP-seq
MIRT1493328	hsa-miR-337-5p	CLIP-seq
MIRT1493329	hsa-miR-338-3p	CLIP-seq
MIRT2369145	hsa-miR-3591-3p	CLIP-seq
MIRT2369146	hsa-miR-3605-5p	CLIP-seq
MIRT1493331	hsa-miR-3612	CLIP-seq
MIRT1493332	hsa-miR-3613-5p	CLIP-seq
MIRT1493414	hsa-miR-3616-3p	CLIP-seq
MIRT2369147	hsa-miR-3662	CLIP-seq
MIRT1493334	hsa-miR-3666	CLIP-seq
MIRT1493335	hsa-miR-3682-5p	CLIP-seq
MIRT1493337	hsa-miR-3692	CLIP-seq
MIRT1493338	hsa-miR-374c	CLIP-seq
MIRT1493339	hsa-miR-381	CLIP-seq
MIRT2148736	hsa-miR-382	CLIP-seq
MIRT1493341	hsa-miR-3923	CLIP-seq
MIRT2148737	hsa-miR-3942-5p	CLIP-seq
MIRT2369148	hsa-miR-421	CLIP-seq
MIRT1493342	hsa-miR-4251	CLIP-seq
MIRT1493343	hsa-miR-4261	CLIP-seq
MIRT1493344	hsa-miR-4262	CLIP-seq
MIRT2369149	hsa-miR-4277	CLIP-seq
MIRT1493345	hsa-miR-4295	CLIP-seq
MIRT1493418	hsa-miR-4303	CLIP-seq
MIRT2148740	hsa-miR-4328	CLIP-seq
MIRT1493348	hsa-miR-4422	CLIP-seq
MIRT1493349	hsa-miR-4427	CLIP-seq
MIRT1493419	hsa-miR-4437	CLIP-seq
MIRT1493350	hsa-miR-4452	CLIP-seq
MIRT2369150	hsa-miR-4459	CLIP-seq
MIRT1493351	hsa-miR-4470	CLIP-seq
MIRT2148743	hsa-miR-4471	CLIP-seq
MIRT1493352	hsa-miR-4473	CLIP-seq
MIRT1493353	hsa-miR-4485	CLIP-seq
MIRT1493355	hsa-miR-452	CLIP-seq
MIRT1493359	hsa-miR-4530	CLIP-seq
MIRT1493360	hsa-miR-454	CLIP-seq
MIRT2148746	hsa-miR-4640-3p	CLIP-seq
MIRT1493361	hsa-miR-4646-5p	CLIP-seq
MIRT1493421	hsa-miR-4649-3p	CLIP-seq
MIRT1493362	hsa-miR-4663	CLIP-seq
MIRT1493363	hsa-miR-4666-3p	CLIP-seq
MIRT1493364	hsa-miR-4666-5p	CLIP-seq
MIRT1493365	hsa-miR-4668-5p	CLIP-seq
MIRT1493366	hsa-miR-4671-3p	CLIP-seq
MIRT2369151	hsa-miR-4672	CLIP-seq
MIRT2369152	hsa-miR-4687-5p	CLIP-seq
MIRT1493367	hsa-miR-4695-5p	CLIP-seq
MIRT1493368	hsa-miR-4698	CLIP-seq
MIRT2148753	hsa-miR-4703-5p	CLIP-seq
MIRT2369153	hsa-miR-4709-5p	CLIP-seq
MIRT1493369	hsa-miR-4712-5p	CLIP-seq
MIRT1493424	hsa-miR-4721	CLIP-seq
MIRT1493425	hsa-miR-4723-5p	CLIP-seq
MIRT1493371	hsa-miR-4729	CLIP-seq
MIRT1493374	hsa-miR-4777-5p	CLIP-seq
MIRT1493427	hsa-miR-4781-5p	CLIP-seq
MIRT2369154	hsa-miR-485-3p	CLIP-seq
MIRT1493428	hsa-miR-496	CLIP-seq
MIRT2369155	hsa-miR-506	CLIP-seq
MIRT1493380	hsa-miR-509-3p	CLIP-seq
MIRT1493381	hsa-miR-5096	CLIP-seq
MIRT1493386	hsa-miR-518d-5p	CLIP-seq
MIRT1493388	hsa-miR-519b-5p	CLIP-seq
MIRT1493389	hsa-miR-519c-5p	CLIP-seq
MIRT1493391	hsa-miR-520c-5p	CLIP-seq
MIRT1493394	hsa-miR-526a	CLIP-seq
MIRT1493395	hsa-miR-539	CLIP-seq
MIRT2148758	hsa-miR-543	CLIP-seq
MIRT1493431	hsa-miR-548ac	CLIP-seq
MIRT1493432	hsa-miR-548ae	CLIP-seq
MIRT1493433	hsa-miR-548aj	CLIP-seq
MIRT1493434	hsa-miR-548am	CLIP-seq
MIRT1493435	hsa-miR-548d-3p	CLIP-seq
MIRT1493399	hsa-miR-548e	CLIP-seq
MIRT1493400	hsa-miR-548f	CLIP-seq
MIRT1493401	hsa-miR-548m	CLIP-seq
MIRT1493402	hsa-miR-548o	CLIP-seq
MIRT1493436	hsa-miR-548x	CLIP-seq
MIRT1493437	hsa-miR-548z	CLIP-seq
MIRT1493438	hsa-miR-556-3p	CLIP-seq
MIRT1493403	hsa-miR-561	CLIP-seq
MIRT1493405	hsa-miR-600	CLIP-seq
MIRT2369156	hsa-miR-624	CLIP-seq
MIRT2369157	hsa-miR-645	CLIP-seq
MIRT1493406	hsa-miR-650	CLIP-seq
MIRT1493407	hsa-miR-655	CLIP-seq
MIRT1493408	hsa-miR-770-5p	CLIP-seq
MIRT1493296	hsa-miR-141	CLIP-seq
MIRT1493309	hsa-miR-200a	CLIP-seq
MIRT1493337	hsa-miR-3692	CLIP-seq
MIRT1493349	hsa-miR-4427	CLIP-seq
MIRT1493380	hsa-miR-509-3p	CLIP-seq
MIRT1493364	hsa-miR-4666-5p	CLIP-seq
MIRT2441676	hsa-miR-1238	CLIP-seq
MIRT1493296	hsa-miR-141	CLIP-seq
MIRT2441677	hsa-miR-193a-3p	CLIP-seq
MIRT2441678	hsa-miR-193b	CLIP-seq
MIRT1493309	hsa-miR-200a	CLIP-seq
MIRT2441679	hsa-miR-4435	CLIP-seq
MIRT2441680	hsa-miR-4474-5p	CLIP-seq
MIRT2441681	hsa-miR-4645-5p	CLIP-seq
MIRT2441682	hsa-miR-4673	CLIP-seq
MIRT2441683	hsa-miR-4755-3p	CLIP-seq
MIRT1493380	hsa-miR-509-3p	CLIP-seq
MIRT2441684	hsa-miR-511	CLIP-seq
MIRT1493438	hsa-miR-556-3p	CLIP-seq
MIRT1493292	hsa-miR-129-5p	CLIP-seq
MIRT2463515	hsa-miR-1305	CLIP-seq
MIRT2463516	hsa-miR-204	CLIP-seq
MIRT2463517	hsa-miR-211	CLIP-seq
MIRT2463518	hsa-miR-2113	CLIP-seq
MIRT2463519	hsa-miR-345	CLIP-seq
MIRT2369145	hsa-miR-3591-3p	CLIP-seq
MIRT2463520	hsa-miR-4256	CLIP-seq
MIRT2369149	hsa-miR-4277	CLIP-seq
MIRT2463521	hsa-miR-4446-5p	CLIP-seq
MIRT2463522	hsa-miR-4755-5p	CLIP-seq
MIRT2463523	hsa-miR-4765	CLIP-seq
MIRT2463524	hsa-miR-599	CLIP-seq
MIRT2463525	hsa-miR-623	CLIP-seq
MIRT2148730	hsa-miR-3124-3p	CLIP-seq
MIRT2441676	hsa-miR-1238	CLIP-seq
MIRT2662735	hsa-miR-1271	CLIP-seq
MIRT2662736	hsa-miR-1287	CLIP-seq
MIRT1493292	hsa-miR-129-5p	CLIP-seq
MIRT2463515	hsa-miR-1305	CLIP-seq
MIRT1493410	hsa-miR-136	CLIP-seq
MIRT1493296	hsa-miR-141	CLIP-seq
MIRT2662737	hsa-miR-150	CLIP-seq
MIRT2662738	hsa-miR-182	CLIP-seq
MIRT2441677	hsa-miR-193a-3p	CLIP-seq
MIRT2441678	hsa-miR-193b	CLIP-seq
MIRT1493309	hsa-miR-200a	CLIP-seq
MIRT2463516	hsa-miR-204	CLIP-seq
MIRT2463517	hsa-miR-211	CLIP-seq
MIRT2463518	hsa-miR-2113	CLIP-seq
MIRT2662739	hsa-miR-2116	CLIP-seq
MIRT2148729	hsa-miR-31	CLIP-seq
MIRT2148730	hsa-miR-3124-3p	CLIP-seq
MIRT2148731	hsa-miR-3128	CLIP-seq
MIRT2662740	hsa-miR-3135b	CLIP-seq
MIRT1493411	hsa-miR-3175	CLIP-seq
MIRT2662741	hsa-miR-3183	CLIP-seq
MIRT2148732	hsa-miR-320b	CLIP-seq
MIRT2148733	hsa-miR-320c	CLIP-seq
MIRT2148734	hsa-miR-320d	CLIP-seq
MIRT1493413	hsa-miR-323b-3p	CLIP-seq
MIRT2463519	hsa-miR-345	CLIP-seq
MIRT2369145	hsa-miR-3591-3p	CLIP-seq
MIRT2662742	hsa-miR-3613-3p	CLIP-seq
MIRT1493332	hsa-miR-3613-5p	CLIP-seq
MIRT1493414	hsa-miR-3616-3p	CLIP-seq
MIRT2662743	hsa-miR-3647-3p	CLIP-seq
MIRT2662744	hsa-miR-3667-3p	CLIP-seq
MIRT1493335	hsa-miR-3682-5p	CLIP-seq
MIRT2148736	hsa-miR-382	CLIP-seq
MIRT1493340	hsa-miR-3913-3p	CLIP-seq
MIRT2463520	hsa-miR-4256	CLIP-seq
MIRT2369149	hsa-miR-4277	CLIP-seq
MIRT1493418	hsa-miR-4303	CLIP-seq
MIRT2662745	hsa-miR-4305	CLIP-seq
MIRT2148742	hsa-miR-4429	CLIP-seq
MIRT2441679	hsa-miR-4435	CLIP-seq
MIRT1493419	hsa-miR-4437	CLIP-seq
MIRT2463521	hsa-miR-4446-5p	CLIP-seq
MIRT2441680	hsa-miR-4474-5p	CLIP-seq
MIRT1493356	hsa-miR-4520a-3p	CLIP-seq
MIRT1493357	hsa-miR-4520b-3p	CLIP-seq
MIRT1493358	hsa-miR-4529-3p	CLIP-seq
MIRT2662746	hsa-miR-4642	CLIP-seq
MIRT2441681	hsa-miR-4645-5p	CLIP-seq
MIRT1493421	hsa-miR-4649-3p	CLIP-seq
MIRT2441682	hsa-miR-4673	CLIP-seq
MIRT2662747	hsa-miR-4677-5p	CLIP-seq
MIRT1493368	hsa-miR-4698	CLIP-seq
MIRT2662748	hsa-miR-4713-5p	CLIP-seq
MIRT2148754	hsa-miR-4720-5p	CLIP-seq
MIRT1493424	hsa-miR-4721	CLIP-seq
MIRT2662749	hsa-miR-4723-3p	CLIP-seq
MIRT1493425	hsa-miR-4723-5p	CLIP-seq
MIRT2441683	hsa-miR-4755-3p	CLIP-seq
MIRT2463522	hsa-miR-4755-5p	CLIP-seq
MIRT2463523	hsa-miR-4765	CLIP-seq
MIRT1493373	hsa-miR-4772-3p	CLIP-seq
MIRT1493374	hsa-miR-4777-5p	CLIP-seq
MIRT1493427	hsa-miR-4781-5p	CLIP-seq
MIRT2148757	hsa-miR-4799-3p	CLIP-seq
MIRT1493379	hsa-miR-495	CLIP-seq
MIRT1493428	hsa-miR-496	CLIP-seq
MIRT1493380	hsa-miR-509-3p	CLIP-seq
MIRT1493381	hsa-miR-5096	CLIP-seq
MIRT2441684	hsa-miR-511	CLIP-seq
MIRT1493382	hsa-miR-518a-3p	CLIP-seq
MIRT1493383	hsa-miR-518b	CLIP-seq
MIRT1493384	hsa-miR-518c	CLIP-seq
MIRT1493385	hsa-miR-518d-3p	CLIP-seq
MIRT1493386	hsa-miR-518d-5p	CLIP-seq
MIRT1493387	hsa-miR-518f	CLIP-seq
MIRT1493388	hsa-miR-519b-5p	CLIP-seq
MIRT1493389	hsa-miR-519c-5p	CLIP-seq
MIRT1493391	hsa-miR-520c-5p	CLIP-seq
MIRT1493394	hsa-miR-526a	CLIP-seq
MIRT2662750	hsa-miR-532-3p	CLIP-seq
MIRT2148758	hsa-miR-543	CLIP-seq
MIRT1493431	hsa-miR-548ac	CLIP-seq
MIRT1493432	hsa-miR-548ae	CLIP-seq
MIRT1493433	hsa-miR-548aj	CLIP-seq
MIRT1493434	hsa-miR-548am	CLIP-seq
MIRT1493435	hsa-miR-548d-3p	CLIP-seq
MIRT1493401	hsa-miR-548m	CLIP-seq
MIRT1493436	hsa-miR-548x	CLIP-seq
MIRT1493437	hsa-miR-548z	CLIP-seq
MIRT1493438	hsa-miR-556-3p	CLIP-seq
MIRT1493439	hsa-miR-582-3p	CLIP-seq
MIRT2463524	hsa-miR-599	CLIP-seq
MIRT1493405	hsa-miR-600	CLIP-seq
MIRT2463525	hsa-miR-623	CLIP-seq
MIRT2662751	hsa-miR-653	CLIP-seq
MIRT2662752	hsa-miR-96	CLIP-seq
MIRT2148730	hsa-miR-3124-3p	CLIP-seq
MIRT2441676	hsa-miR-1238	CLIP-seq
MIRT2695243	hsa-miR-1269	CLIP-seq
MIRT2695244	hsa-miR-1269b	CLIP-seq
MIRT2662735	hsa-miR-1271	CLIP-seq
MIRT2662736	hsa-miR-1287	CLIP-seq
MIRT2695245	hsa-miR-1288	CLIP-seq
MIRT1493292	hsa-miR-129-5p	CLIP-seq
MIRT2463515	hsa-miR-1305	CLIP-seq
MIRT1493410	hsa-miR-136	CLIP-seq
MIRT1493296	hsa-miR-141	CLIP-seq
MIRT2662737	hsa-miR-150	CLIP-seq
MIRT2662738	hsa-miR-182	CLIP-seq
MIRT2441677	hsa-miR-193a-3p	CLIP-seq
MIRT2441678	hsa-miR-193b	CLIP-seq
MIRT1493309	hsa-miR-200a	CLIP-seq
MIRT2463516	hsa-miR-204	CLIP-seq
MIRT2463517	hsa-miR-211	CLIP-seq
MIRT2463518	hsa-miR-2113	CLIP-seq
MIRT2662739	hsa-miR-2116	CLIP-seq
MIRT2148729	hsa-miR-31	CLIP-seq
MIRT2148730	hsa-miR-3124-3p	CLIP-seq
MIRT2148731	hsa-miR-3128	CLIP-seq
MIRT2662740	hsa-miR-3135b	CLIP-seq
MIRT1493411	hsa-miR-3175	CLIP-seq
MIRT2662741	hsa-miR-3183	CLIP-seq
MIRT2148732	hsa-miR-320b	CLIP-seq
MIRT2148733	hsa-miR-320c	CLIP-seq
MIRT2148734	hsa-miR-320d	CLIP-seq
MIRT1493413	hsa-miR-323b-3p	CLIP-seq
MIRT2463519	hsa-miR-345	CLIP-seq
MIRT2369145	hsa-miR-3591-3p	CLIP-seq
MIRT2662742	hsa-miR-3613-3p	CLIP-seq
MIRT1493332	hsa-miR-3613-5p	CLIP-seq
MIRT1493414	hsa-miR-3616-3p	CLIP-seq
MIRT2662743	hsa-miR-3647-3p	CLIP-seq
MIRT2662744	hsa-miR-3667-3p	CLIP-seq
MIRT1493335	hsa-miR-3682-5p	CLIP-seq
MIRT2695246	hsa-miR-378	CLIP-seq
MIRT2695247	hsa-miR-378b	CLIP-seq
MIRT2695248	hsa-miR-378c	CLIP-seq
MIRT2695249	hsa-miR-378d	CLIP-seq
MIRT2695250	hsa-miR-378e	CLIP-seq
MIRT2695251	hsa-miR-378f	CLIP-seq
MIRT2695252	hsa-miR-378h	CLIP-seq
MIRT2695253	hsa-miR-378i	CLIP-seq
MIRT2148736	hsa-miR-382	CLIP-seq
MIRT1493340	hsa-miR-3913-3p	CLIP-seq
MIRT2695254	hsa-miR-422a	CLIP-seq
MIRT2463520	hsa-miR-4256	CLIP-seq
MIRT2369149	hsa-miR-4277	CLIP-seq
MIRT1493418	hsa-miR-4303	CLIP-seq
MIRT2662745	hsa-miR-4305	CLIP-seq
MIRT2148742	hsa-miR-4429	CLIP-seq
MIRT2441679	hsa-miR-4435	CLIP-seq
MIRT1493419	hsa-miR-4437	CLIP-seq
MIRT2463521	hsa-miR-4446-5p	CLIP-seq
MIRT2695255	hsa-miR-4515	CLIP-seq
MIRT1493356	hsa-miR-4520a-3p	CLIP-seq
MIRT1493357	hsa-miR-4520b-3p	CLIP-seq
MIRT1493358	hsa-miR-4529-3p	CLIP-seq
MIRT2662746	hsa-miR-4642	CLIP-seq
MIRT2441681	hsa-miR-4645-5p	CLIP-seq
MIRT1493421	hsa-miR-4649-3p	CLIP-seq
MIRT2441682	hsa-miR-4673	CLIP-seq
MIRT2662747	hsa-miR-4677-5p	CLIP-seq
MIRT1493368	hsa-miR-4698	CLIP-seq
MIRT2662748	hsa-miR-4713-5p	CLIP-seq
MIRT2148754	hsa-miR-4720-5p	CLIP-seq
MIRT1493424	hsa-miR-4721	CLIP-seq
MIRT2662749	hsa-miR-4723-3p	CLIP-seq
MIRT1493425	hsa-miR-4723-5p	CLIP-seq
MIRT2695256	hsa-miR-4740-5p	CLIP-seq
MIRT2441683	hsa-miR-4755-3p	CLIP-seq
MIRT2463522	hsa-miR-4755-5p	CLIP-seq
MIRT1493426	hsa-miR-4760-3p	CLIP-seq
MIRT2463523	hsa-miR-4765	CLIP-seq
MIRT1493373	hsa-miR-4772-3p	CLIP-seq
MIRT1493427	hsa-miR-4781-5p	CLIP-seq
MIRT2148757	hsa-miR-4799-3p	CLIP-seq
MIRT1493379	hsa-miR-495	CLIP-seq
MIRT1493428	hsa-miR-496	CLIP-seq
MIRT1493380	hsa-miR-509-3p	CLIP-seq
MIRT1493382	hsa-miR-518a-3p	CLIP-seq
MIRT1493383	hsa-miR-518b	CLIP-seq
MIRT1493384	hsa-miR-518c	CLIP-seq
MIRT1493385	hsa-miR-518d-3p	CLIP-seq
MIRT1493387	hsa-miR-518f	CLIP-seq
MIRT2662750	hsa-miR-532-3p	CLIP-seq
MIRT2148758	hsa-miR-543	CLIP-seq
MIRT1493431	hsa-miR-548ac	CLIP-seq
MIRT1493432	hsa-miR-548ae	CLIP-seq
MIRT1493433	hsa-miR-548aj	CLIP-seq
MIRT1493434	hsa-miR-548am	CLIP-seq
MIRT1493435	hsa-miR-548d-3p	CLIP-seq
MIRT1493436	hsa-miR-548x	CLIP-seq
MIRT1493437	hsa-miR-548z	CLIP-seq
MIRT1493438	hsa-miR-556-3p	CLIP-seq
MIRT1493439	hsa-miR-582-3p	CLIP-seq
MIRT2463524	hsa-miR-599	CLIP-seq
MIRT1493405	hsa-miR-600	CLIP-seq
MIRT2463525	hsa-miR-623	CLIP-seq
MIRT2695257	hsa-miR-630	CLIP-seq
MIRT2662751	hsa-miR-653	CLIP-seq
MIRT2662752	hsa-miR-96	CLIP-seq

Show/Hide all (86)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0002028	Process	Regulation of sodium ion transport	ISS
GO:0003084	Process	Positive regulation of systemic arterial blood pressure	IEA
GO:0004672	Function	Protein kinase activity	IEA
GO:0004672	Function	Protein kinase activity	IMP	16669787
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA	10660600, 15883153, 16263722, 16832045, 17190791, 19665974, 19739668, 21321328, 22989884, 25362046, 29196535, 31656913, 34289367, 36318922
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	ISS	27400149
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	24393035
GO:0005515	Function	Protein binding	IPI	15350218, 16832045, 17721439, 19389623, 20936779, 28514442, 33961781, 33964204, 35044719, 35271311, 36931259, 39251607
GO:0005524	Function	ATP binding	IDA	10660600
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	29196535
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	10660600
GO:0005737	Component	Cytoplasm	IEA
GO:0005819	Component	Spindle	IEA
GO:0005829	Component	Cytosol	IDA	17190791
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	ISS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006468	Process	Protein phosphorylation	IDA	10660600
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006811	Process	Monoatomic ion transport	ISS
GO:0006884	Process	Cell volume homeostasis	IDA	19665974, 21321328
GO:0006884	Process	Cell volume homeostasis	IDA	36318922
GO:0006884	Process	Cell volume homeostasis	TAS	27782176
GO:0006974	Process	DNA damage response	IBA
GO:0007165	Process	Signal transduction	IDA	16669787
GO:0007507	Process	Heart development	IEA
GO:0008217	Process	Regulation of blood pressure	IEA
GO:0010507	Process	Negative regulation of autophagy	IMP	27911840
GO:0010766	Process	Negative regulation of sodium ion transport	ISS
GO:0010793	Process	Regulation of mRNA export from nucleus	IDA	29196535
GO:0010820	Process	Positive regulation of T cell chemotaxis	IMP	27400149
GO:0016020	Component	Membrane	ISS
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0019901	Function	Protein kinase binding	IPI	16669787
GO:0019902	Function	Phosphatase binding	IDA	19389623
GO:0030295	Function	Protein kinase activator activity	IMP	16669787
GO:0030644	Process	Intracellular chloride ion homeostasis	IEA
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	33964204
GO:0032991	Component	Protein-containing complex	IEA
GO:0033633	Process	Negative regulation of cell-cell adhesion mediated by integrin	IMP	27400149
GO:0034115	Process	Negative regulation of heterotypic cell-cell adhesion	IMP	27400149
GO:0035556	Process	Intracellular signal transduction	IDA	10660600
GO:0035556	Process	Intracellular signal transduction	TAS	24393035
GO:0035725	Process	Sodium ion transmembrane transport	IEA
GO:0038116	Process	Chemokine (C-C motif) ligand 21 signaling pathway	IEA
GO:0038116	Process	Chemokine (C-C motif) ligand 21 signaling pathway	ISS	27400149
GO:0042592	Process	Homeostatic process	IEA
GO:0043232	Component	Intracellular membraneless organelle	IDA	36318922
GO:0045050	Process	Protein insertion into ER membrane by stop-transfer membrane-anchor sequence	IDA	33964204
GO:0045766	Process	Positive regulation of angiogenesis	IEA
GO:0045766	Process	Positive regulation of angiogenesis	IMP	25362046
GO:0048666	Process	Neuron development	NAS	15060842
GO:0050852	Process	T cell receptor signaling pathway	IEA
GO:0050852	Process	T cell receptor signaling pathway	ISS	27400149
GO:0051058	Process	Negative regulation of small GTPase mediated signal transduction	IEA
GO:0051058	Process	Negative regulation of small GTPase mediated signal transduction	IMP	27400149
GO:0055075	Process	Potassium ion homeostasis	IEA
GO:0055080	Process	Monoatomic cation homeostasis	IEA
GO:0055080	Process	Monoatomic cation homeostasis	ISS
GO:0071474	Process	Cellular hyperosmotic response	IDA	15883153, 17190791, 34289367, 36318922
GO:0071805	Process	Potassium ion transmembrane transport	IDA	19665974
GO:0072686	Component	Mitotic spindle	IDA	21220314
GO:0090188	Process	Negative regulation of pancreatic juice secretion	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IEA
GO:0090263	Process	Positive regulation of canonical Wnt signaling pathway	IMP	23797875
GO:0097022	Process	Lymphocyte migration into lymph node	IEA
GO:0097022	Process	Lymphocyte migration into lymph node	ISS	27400149
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0140693	Function	Molecular condensate scaffold activity	IDA	36318922
GO:0140694	Process	Membraneless organelle assembly	IDA	36318922
GO:1902305	Process	Regulation of sodium ion transmembrane transport	IEA
GO:1903038	Process	Negative regulation of leukocyte cell-cell adhesion	IMP	27400149
GO:1903077	Process	Negative regulation of protein localization to plasma membrane	ISS
GO:1903490	Process	Positive regulation of mitotic cytokinesis	IDA	21220314
GO:1904062	Process	Regulation of monoatomic cation transmembrane transport	IEA
GO:1904062	Process	Regulation of monoatomic cation transmembrane transport	IMP	27782176
GO:1904595	Process	Positive regulation of termination of RNA polymerase II transcription	IDA	29196535
GO:1990869	Process	Cellular response to chemokine	IEA
GO:1990869	Process	Cellular response to chemokine	IMP	27400149

MIM	HGNC	e!Ensembl
605232	14540	ENSG00000060237

Q9H4A3

Protein name

Serine/threonine-protein kinase WNK1 (EC 2.7.11.1) (Erythrocyte 65 kDa protein) (p65) (Kinase deficient protein) (Protein kinase lysine-deficient 1) (Protein kinase with no lysine 1) (hWNK1)

Protein function

Serine/threonine-protein kinase component of the WNK1-SPAK/OSR1 kinase cascade, which acts as a key regulator of blood pressure and regulatory volume increase by promoting ion influx (PubMed:15883153, PubMed:17190791, PubMed:31656913, PubMed:342

PDB

4PWN , 5TF9 , 5WDY , 5WE8 , 6FBK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	221 → 479	Protein kinase domain	Domain
PF12202	OSR1_C	500 → 563	Oxidative-stress-responsive kinase 1 C-terminal domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed, with highest levels observed in the testis, heart, kidney and skeletal muscle. {ECO:0000269|PubMed:10660600, ECO:0000269|PubMed:11571656, ECO:0000269|PubMed:22701532}.; TISSUE SPECIFICITY: [Isoform 1]: Strong expressi

Sequence

MSGGAAEKQSSTPGSLFLSPPAPAPKNGSSSDSSVGEKLGAAAADAVTGRTEEYRRRRHT
MDKDSRGAAATTTTTEHRFFRRSVICDSNATALELPGLPLSLPQPSIPAAVPQSAPPEPH
REETVTATATSQVAQQPPAAAAPGEQAVAGPAPSTVPSSTSKDRPVSQPSLVGSKEEPPP
ARSGSGGGSAKEPQEERSQQQDDIEELETKAVGMSNDGRFLKFDIEIGRGSFKTVYKGLD
TETTVEVAWCELQDRKLTKSERQRFKEEAEMLKGLQHPNIVRFYDSWESTVKGKKCIVLV
TELMTSGTLKTYLKRFKVMKIKVLRSWCRQILKGLQFLHTRTPPIIHRDLKCDNIFITGP
TGSVKIGDLGLATLKRASFAKSVIGTPEFMAPEMYEEKYDESVDVYAFGMCMLEMATSEY
PYSECQNAAQIYRRVTSGVKPASFDKVAIPEVKEIIEGCIRQNKDERYSIKDLLNHAFFQ
EETGVRVELAEEDDGEKIAIKLWLRIEDIKKLKGKYKDNEAIEFSFDLERDVPEDVAQEM
VESGYVCEGDHKTMAKAIKDRVSLIKRKREQRQLVREEQEKKKQEESSLKQQVEQSSASQ
TGIKQLPSASTGIPTASTTSASVSTQVEPEEPEADQHQQLQYQQPSISVLSDGTVDSGQG
SSVFTESRVSSQQTVSYGSQHEQAHSTGTVPGHIPSTVQAQSQPHGVYPPSSVAQGQSQG
QPSSSSLTGVSSSQPIQHPQQQQGIQQTAPPQQTVQYSLSQTSTSSEATTAQPVSQPQAP
QVLPQVSAGKQLPVSQPVPTIQGEPQIPVATQPSVVPVHSGAHFLPVGQPLPTPLLPQYP
VSQIPISTPHVSTAQTGFSSLPITMAAGITQPLLTLASSATTAAIPGVSTVVPSQLPTLL
QPVTQLPSQVHPQLLQPAVQSMGIPANLGQAAEVPLSSGDVLYQGFPPRLPPQYPGDSNI
APSSNVASVCIHSTVLSPPMPTEVLATPGYFPTVVQPYVESNLLVPMGGVGGQVQVSQPG
GSLAQAPTTSSQQAVLESTQGVSQVAPAEPVAVAQTQATQPTTLASSVDSAHSDVASGMS
DGNENVPSSSGRHEGRTTKRHYRKSVRSRSRHEKTSRPKLRILNVSNKGDRVVECQLETH
NRKMVTFKFDLDGDNPEEIATIMVNNDFILAIERESFVDQVREIIEKADEMLSEDVSVEP
EGDQGLESLQGKDDYGFSGSQKLEGEFKQPIPASSMPQQIGIPTSSLTQVVHSAGRRFIV
SPVPESRLRESKVFPSEITDTVAASTAQSPGMNLSHSASSLSLQQAFSELRRAQMTEGPN
TAPPNFSHTGPTFPVVPPFLSSIAGVPTTAAATAPVPATSSPPNDISTSVIQSEVTVPTE
EGIAGVATSTGVVTSGGLPIPPVSESPVLSSVVSSITIPAVVSISTTSPSLQVPTSTSEI
VVSSTALYPSVTVSATSASAGGSTATPGPKPPAVVSQQAAGSTTVGATLTSVSTTTSFPS
TASQLCIQLSSSTSTPTLAETVVVSAHSLDKTSHSSTTGLAFSLSAPSSSSSPGAGVSSY
ISQPGGLHPLVIPSVIASTPILPQAAGPTSTPLLPQVPSIPPLVQPVANVPAVQQTLIHS
QPQPALLPNQPHTHCPEVDSDTQPKAPGIDDIKTLEEKLRSLFSEHSSSGAQHASVSLET
SLVIESTVTPGIPTTAVAPSKLLTSTTSTCLPPTNLPLGTVALPVTPVVTPGQVSTPVST
TTSGVKPGTAPSKPPLTKAPVLPVGTELPAGTLPSEQLPPFPGPSLTQSQQPLEDLDAQL
RRTLSPEMITVTSAVGPVSMAAPTAITEAGTQPQKGVSQVKEGPVLATSSGAGVFKMGRF
QVSVAADGAQKEGKNKSEDAKSVHFESSTSESSVLSSSSPESTLVKPEPNGITIPGISSD
VPESAHKTTASEAKSDTGQPTKVGRFQVTTTANKVGRFSVSKTEDKITDTKKEGPVASPP
FMDLEQAVLPAVIPKKEKPELSEPSHLNGPSSDPEAAFLSRDVDDGSGSPHSPHQLSSKS
LPSQNLSQSLSNSFNSSYMSSDNESDIEDEDLKLELRRLRDKHLKEIQDLQSRQKHEIES
LYTKLGKVPPAVIIPPAAPLSGRRRRPTKSKGSKSSRSSSLGNKSPQLSGNLSGQSAASV
LHPQQTLHPPGNIPESGQNQLLQPLKPSPSSDNLYSAFTSDGAISVPSLSAPGQGTSSTN
TVGATVNSQAAQAQPPAMTSSRKGTFTDDLHKLVDNWARDAMNLSGRRGSKGHMNYEGPG
MARKFSAPGQLCISMTSNLGGSAPISAASATSLGHFTKSMCPPQQYGFPATPFGAQWSGT
GGPAPQPLGQFQPVGTASLQNFNISNLQKSISNPPGSNLRTT

Sequence length

2382

Interactions

View interactions

	KEGG		Reactome
	Parathyroid hormone synthesis, secretion and action		Stimuli-sensing channels

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hereditary neuropathy or pain disorder	Pathogenic	rs111033591	RCV005865158	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neuropathy, hereditary sensory and autonomic, type 2A	Pathogenic; Likely pathogenic	rs2154071377, rs2154071399, rs2154071927, rs2154096075, rs2154072180, rs2154071932, rs1951918264, rs750907088, rs768622577, rs111033592, rs111033590, rs111033591, rs387906331, rs387906332, rs1194157372 View all (38 more)	RCV001381962 RCV001383729 RCV001389427 RCV002050443 RCV001900804 View all (48 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Pseudohypoaldosteronism type 2C	Likely pathogenic; Pathogenic	rs746484082, rs2154071377, rs2154071399, rs2154071927, rs2154096075, rs2154072180, rs2154071932, rs1951918264, rs750907088, rs768622577, rs111033590, rs111033591, rs1194157372, rs2548597368, rs2548836529 View all (21 more)	RCV004577622 RCV001381962 RCV001383729 RCV001389427 RCV002050443 View all (31 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (47)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL SEROUS RETINOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Charcot-Marie-Tooth disease	Conflicting classifications of pathogenicity; Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Clear cell carcinoma of kidney	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY MOTOR AND SENSORY NEUROPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary motor and sensory neuropathy	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY SENSORY AND AUTONOMIC NEUROPATHIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary sensory and autonomic neuropathy type 2	Conflicting classifications of pathogenicity; Likely benign; Uncertain significance; Benign	ClinVar ClinVar, GWAS catalog, Orphanet ClinVar, GWAS catalog, Orphanet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
HEREDITARY SENSORY AND AUTONOMIC NEUROPATHY TYPE II	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY SENSORY AUTONOMIC NEUROPATHY, TYPE 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY SENSORY AUTONOMIC NEUROPATHY, TYPE 2	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY SENSORY AUTONOMIC NEUROPATHY, TYPE 5	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Conflicting classifications of pathogenicity; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROPATHY, HEREDITARY SENSORY AND AUTONOMIC, TYPE IIA	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL NEUROPATHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSEUDOHYPOALDOSTERONISM	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudohypoaldosteronism type 2A	Conflicting classifications of pathogenicity; Likely benign; Uncertain significance; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSEUDOHYPOALDOSTERONISM, TYPE IIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSEUDOHYPOALDOSTERONISM, TYPE IIC	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORY NEUROPATHY, HEREDITARY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Variant of unknown significance	Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WNK1-related disorder	Conflicting classifications of pathogenicity; Benign; Likely benign; Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (326)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acro-Osteolysis	Acrosteolysis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	26378023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	12458326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	21901538		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	27959400, 30570131, 31671079		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	12214859, 28317833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	17078054, 17493236, 9918209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	25499851, 25820700, 29207489, 30797499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	16849549, 20556833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	12722795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	26910375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12458326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	21161674, 21492457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	16453001, 25706397, 29600938, 30258009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	18842138, 27050411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	15660915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22084410, 27512062		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhedonia	Anhedonia	BEFREE	30326340		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhidrosis	Anhidrosis	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	22984424, 31485664		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	23592772, 27453460, 27454293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Apparent mineralocorticoid excess	Apparent Mineralocorticoid Excess	BEFREE	17647025		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29257205, 31637885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	21683061, 26370562, 28107661		★★★★★ ★☆☆☆☆ Found in Text Mining only
ARTHROGRYPOSIS MULTIPLEX CONGENITA, DISTAL, TYPE IIA	Gordon syndrome	BEFREE	15888480, 15980941, 21248166, 23683032, 25503323		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	29932372		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11381677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29257205, 31637885		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autonomic Nervous System Diseases	Autonomic nervous system disease	Pubtator	27765018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autonomic nervous system disorders	Autonomic Central Nervous System Diseases	BEFREE	22910560, 27765018		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	29896252, 30688264, 31579948, 31599399		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	15744353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	25369740, 28629334, 28772241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	25029242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	27050411	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Infarction	Brain Infarction	BEFREE	31203481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15029197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15481028, 22821148, 25544568, 27840899, 29041983, 29181822, 30052635, 31077746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	37307465	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	25487615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	27765018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17078054, 19157506, 20546338, 26450901		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32871793, 36618969, 37787401	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	25369740, 28629334, 28772241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	29573243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	17078054, 24469051, 27046058, 27050278, 30797499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	28167529, 29050320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiac defects	Cardiac Defects	BEFREE	23386621		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	18842138, 31494123		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	18842138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	21999375, 30911939		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17098279, 23382863, 23640294, 25960241, 31460012, 31545447		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	17098279, 23382863, 23640294, 25960241, 31460012, 31545447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10720133, 12458326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	21161674, 21492457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	28259870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29904119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic leukemia (category)	Leukemia	BEFREE	12458326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	12458326, 15744353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29932372, 30588579		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28153604, 28216640, 29901086, 30430451, 8782457		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	15013430, 24001836, 26942699, 31838134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	22949302, 27175800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15028307, 15484295, 16284690, 20501702, 22869145, 27338835, 28817833, 30816524, 30825051		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22860045	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Pain Insensitivity	Congenital Pain Insensitivity	BEFREE	19651702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	20797985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	21167650, 29935727, 31022353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	28355355, 29849452, 31821324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	31821324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	31821324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	30581189, 31821324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	8782457, 9928378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17194447, 25033378, 31607634		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystitis	Cystitis	BEFREE	25369740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	20822710, 26209501, 26816250, 28000846, 28482921, 28537665, 28642243, 29072705, 29333456, 31545916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dejerine-Sottas Disease (disorder)	Charcot-Marie-Tooth disease	BEFREE	21905285, 30665389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	23585562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Demyelinating Diseases	Demyelinating diseases	Pubtator	27765018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dentatorubral-Pallidoluysian Atrophy	Dentatorubral Pallidoluysian Atrophy	BEFREE	26907088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis	Dermatitis	BEFREE	28464025, 29767264, 30551443, 30642981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	BEFREE	15660915, 28713916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	BEFREE	28713916		★★★★★ ★☆☆☆☆ Found in Text Mining only
Deuteranomaly	Deuteranomaly	BEFREE	31032942		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28534138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28534138		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	31506348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37812879	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	30076618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	29475461, 30410865, 31816312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	24608443, 24936866, 28478303, 29104634, 30038056		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	29853786, 31599399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	22438958		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	26498772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	23830204		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dysautonomia	Dysautonomia	BEFREE	22910560		★★★★★ ★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	31638207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eclampsia	Eclampsia	BEFREE	21515911		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	BEFREE	15660915		★★★★★ ★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	31049785		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22711307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	24118362, 29679753		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	24118362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	29393419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	28402943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28167529		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	22292433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	22292433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	15888480, 18277144, 18547946, 21530900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	19347040, 31337952	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	24501220		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	24501220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver Disease	Fatty Liver	BEFREE	28038359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	8234333		★★★★★ ★☆☆☆☆ Found in Text Mining only
Follicular adenoma	Adenoma	BEFREE	12722795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	Pubtator	27765018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroenteritis	Gastroenteritis	BEFREE	30322331		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	27469332	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gingivitis	Gingivitis	BEFREE	25037760		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	31093481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	11381677, 21423202, 24244348, 27994064, 28465487, 28497156, 29062041, 29449895, 29930759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	11381677, 21423202, 24244348, 27994064, 28465487, 28497156, 29062041, 29449895, 29930759, 31332862		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24555568	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28465487, 28969029, 30740911, 30779920, 30978403		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glucocorticoid Receptor Deficiency	Glucocorticoid Receptor Deficiency	BEFREE	15200413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gordon syndrome	Gorlin syndrome	Pubtator	23387299	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	24501220		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gray Platelet Syndrome	Gray Platelet Syndrome	BEFREE	28450921		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hamartoma Syndrome, Multiple	Hamartoma	BEFREE	31572379		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	20797985		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Motor and Sensory-Neuropathy Type II	Dysautonomia	BEFREE	15060842, 16534117, 21248166, 27765018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Motor and Sensory-Neuropathy Type II	Dysautonomia	GENOMICS_ENGLAND_DG	15060842		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	Pubtator	15060842, 19228968, 19651702, 21820098, 22302274, 27765018, 30497409, 36151370, 37793538	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory and Autonomic Neuropathies	Hereditary sensory and autonomic neuropathy	BEFREE	18348718, 19651702, 27765018, 28422281, 31132985		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary sensory and autonomic neuropathy type 2	Hereditary Sensory And Autonomic Neuropathy	Orphanet			★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Hereditary Sensory and Autonomic Neuropathy Type Ie	Hereditary sensory and autonomic neuropathy	Pubtator	27765018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Sensory Autonomic Neuropathy, Type 2	Hereditary sensory and autonomic neuropathy	BEFREE	15060842, 15455397, 15911806, 16534117, 16636245, 16946995, 18521183, 19228968, 21248166, 21820098, 22910560, 23300475, 27765018, 30497409		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary Sensory Autonomic Neuropathy, Type 2	Hereditary sensory and autonomic neuropathy	CLINVAR_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperchloremia	Hyperchloremia	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	18809715, 19208907, 20599797, 25610879, 28148567, 30151392, 30410865		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	31678650		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperkalemia	Hyperkalemia	Pubtator	17380208, 18550644, 37895227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperpotassemia and Hypertension, Familial	Hyperpotassemia And Hypertension	CTD_human_DG	22949526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypersplenism	Hypersplenism	BEFREE	23195252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	12202761, 12374799, 14611643, 14681216, 16669787, 17380208, 18550644, 19347040, 21520334, 22032326, 23059770, 24266877, 27082544, 35442829, 36151370	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	14610273, 14611643, 15300163, 15309683, 15686619, 15888480, 16083423, 16669787, 18277144, 18701621, 21170890, 21704025, 22080857, 23059770, 23336180 View all (10 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	15583131		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	22949526		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperthyroidism	Hyperthyroidism	BEFREE	18472049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperuricemia	Hyperuricemia	BEFREE	31252266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	29442198, 30591962, 31841209		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30928090		★★★★★ ★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	19037255, 29230705, 30519926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31660818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory abnormality of the eye	Inflammatory abnormality of the eye	BEFREE	28609207		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	29156761, 9928378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory dermatosis	Dermatitis	BEFREE	28464025, 30642981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	28646230, 30076618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	30076618		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial Aneurysm	BEFREE	30808715		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	11753981		★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable Bowel Syndrome	BEFREE	28525373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	30961627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	36811882	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	CTD_human_DG	21865292		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	28315683, 29723660, 31044551, 31754396		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Failure, Acute	Kidney Failure	BEFREE	30257316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	21832251		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	31022353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lambert-Eaton Myasthenic Syndrome	Lambert-Eaton Myasthenic Syndrome	BEFREE	31236596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	26395262		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12458326, 23445492, 28832545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12458326, 19079347, 23077289, 23457487, 25092144		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	16453001, 25706397, 29600938, 30258009		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	16998793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16544977, 18972404, 21771706, 22008847, 22293202, 22930530, 23054188, 24760275, 26458400, 28260799, 28423737, 29029515, 29089476, 29616186, 29988727 View all (5 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	23195252		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	30497409	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28447718, 29191769		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21771706, 22008847, 22293202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	28969021		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37980468	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	28295231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	28295231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12027419, 12847689, 28295231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	28295231		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	30542119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Bone Neoplasm	Malignant Bone Neoplasm	BEFREE	31085334		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15481028, 17369819, 22821148, 25544568, 27840899, 29041983, 29181822, 30052635, 31077746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22711307		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	22292433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	31187116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	29573243		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	21771706		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	17078054, 24469051, 27046058, 27050278, 30797499		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	16998793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	25487615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29050320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	19880242, 20686216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	12569576, 12727841, 21169414, 24066029, 25749044, 26165401, 26359363, 26450901, 27673408, 31265453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16284690, 19414318, 24673584, 26934326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	12722795, 29525603, 30171715, 31181609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	25369740, 28629334, 28772241		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15028307, 15192014, 15328189, 17403432, 17671195, 18519709, 19201992, 20009901, 22941571, 25405520, 26592237, 26934326, 27050278, 27454293, 28397014 View all (14 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17098279, 23382863, 23640294, 25960241, 31460012, 31545447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	15013430, 24001836, 26942699, 31838134		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22941571, 24970818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	21161674, 21492457		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24130172, 25277211, 28821433		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	28178938	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	26052894		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	19079347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	28587409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	16917511		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25565020		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	39271659	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17258784, 17889033, 26062845, 29503661, 29655870, 31362762		★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Duchenne	Duchenne Muscular Dystrophy	BEFREE	17380205, 27997693		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	19079347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	20482842, 27492973, 28461114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	28355355, 29849452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	19068102, 21442076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	15967702, 20051109, 23975427, 25487615, 31427673		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10416616, 10870681, 11753981, 12740642, 15028307, 15210855, 15561777, 1566083, 16327981, 17078054, 18079962, 19201992, 19414318, 21901538, 22186294 View all (33 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	28849172		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neural Tube Defects	Neural Tube Defect	BEFREE	28865949		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19515614, 20103633, 23071666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	30946927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy	Neuropathy	BEFREE	15911806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy Hereditary Sensory And Autonomic Type IIB	Hereditary sensory and autonomic neuropathy	Pubtator	31132985	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuropathy, Hereditary Sensory And Autonomic, Type IIA	Neuropathy	GENOMICS_ENGLAND_DG	11498583, 15060842, 16636245, 16946995		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuropathy, Hereditary Sensory And Autonomic, Type IIA	Neuropathy	CLINVAR_DG	15060842, 15911806		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neuropathy, Hereditary Sensory And Autonomic, Type IIA	Neuropathy	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	20051109		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	31252266		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	17078054, 25156800, 26336823, 28969021, 29363879, 29535539, 30932261		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29202451		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28829242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	29091322, 30854667		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28478803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29628496, 29847772, 30387173, 31262893		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	29050320		★★★★★ ★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	24001836		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pain Insensitivity Congenital	Congenital pain insensitivity	Pubtator	19651702	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	19880242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	20556833, 27454293		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	19880242		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	29359164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	31561038	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	16849549, 17962362		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	25803323, 26637328, 31181609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paronychia Inflammation	Paronychia Inflammation	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelger-Huet Anomaly	Pelger-Huet Anomaly	BEFREE	8450395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pelvic Organ Prolapse	Pelvic Organ Prolapse	BEFREE	25739019		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periapical Periodontitis	Periapical Periodontitis	BEFREE	30184545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	25037760, 29287688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	23300475		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	23300475		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEROXISOME BIOGENESIS DISORDER, COMPLEMENTATION GROUP A	Zellweger Syndrome	BEFREE	28028753		★★★★★ ★☆☆☆☆ Found in Text Mining only
PIGMENTARY DISORDER, RETICULATE, WITH SYSTEMIC MANIFESTATIONS	Pigmentary Disorder, Reticulate, With Systemic Manifestations	BEFREE	28402943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyendocrinopathies, Autoimmune	Autoimmune Polyendocrinopathy	BEFREE	28734155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	23585562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Primary Ciliary Dyskinesia	Ciliary dyskinesia	BEFREE	31236596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Proliferative diabetic retinopathy	Proliferative Diabetic Retinopathy	BEFREE	28402943		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	12569576, 12727841, 15498932, 24066029, 25749044, 26165401, 26359363, 26450901, 27673408, 31265453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	15328189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26253870		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoaldosteronism	Pseudohypoparathyroidism	Pubtator	14611643, 17380208, 35093948, 35442829, 36151370	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudohypoaldosteronism	Pseudohypoaldosteronism	BEFREE	21248166		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudohypoaldosteronism	Pseudohypoaldosteronism	CTD_human_DG	22949526		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudohypoaldosteronism	Pseudohypoaldosteronism	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudohypoaldosteronism type 2C	Pseudohypoaldosteronism	Orphanet			★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Pseudohypoaldosteronism, Type I	Pseudohypoaldosteronism	CTD_human_DG	22949526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoaldosteronism, Type I, Autosomal Dominant	Pseudohypoaldosteronism	CTD_human_DG	22949526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoaldosteronism, Type I, Autosomal Recessive	Pseudohypoaldosteronism	CTD_human_DG	22949526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoaldosteronism, Type II	Pseudohypoaldosteronism	BEFREE	14610273, 14611643, 15300163, 15309683, 15637347, 15686619, 15866321, 15888480, 15980941, 18521183, 18547946, 18701621, 21131289, 21170890, 21196779 View all (13 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoaldosteronism, Type II	Pseudohypoaldosteronism	CTD_human_DG	22949526		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pseudohypoaldosteronism, Type IIc	Pseudohypoaldosteronism	GENOMICS_ENGLAND_DG	11498583, 15060842		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudohypoaldosteronism, Type IIc	Pseudohypoaldosteronism	CLINVAR_DG	15060842, 15911806		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pseudohypoaldosteronism, Type IIc	Pseudohypoaldosteronism	CTD_human_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSEUDOHYPOALDOSTERONISM, TYPE IID	Pseudohypoaldosteronism	BEFREE	17194447, 18955660, 21248166, 22406640, 25113964, 29459793, 29846116, 30967423		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28713916, 30551443		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	23583295		★★★★★ ★☆☆☆☆ Found in Text Mining only
RELA fusion-positive ependymoma	RELA Fusion-Positive Ependymoma	BEFREE	30929114		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	31187116		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29935727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Respiratory Distress Syndrome, Adult	Respiratory Distress Syndrome	BEFREE	31214773, 31281400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	29914080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	34720057	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20494139		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11884470, 19877072, 20822710, 21683061, 23072581, 26370562, 28467992, 28783661, 29784872, 29966968, 30152858, 31239367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma	Scleroderma	BEFREE	22139845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	23585562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sensory Neuropathy, Hereditary	Sensory Neuropathy, Hereditary	BEFREE	18521183, 22910560		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Septicemia	Septicemia	BEFREE	15972680, 24913772, 26159927, 28800541		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sinusitis	Sinusitis	BEFREE	17040605		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Ulcer	Skin ulcer	Pubtator	27765018	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	27754829		★★★★★ ★☆☆☆☆ Found in Text Mining only
Spinal Muscular Atrophy	Spinal Muscular Atrophy	BEFREE	31019235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	11753981, 17237265, 20051109		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16680372, 22186294, 22552693, 26439687, 26718331, 30542119		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	GWASCAT_DG	28604730		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	30646812		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	20716363, 24063540		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29518496, 30250646		★★★★★ ★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	31061316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	18290776		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steroid resistant nephrotic syndrome of childhood	Steroid resistant nephrotic syndrome	BEFREE	15200413		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11751513, 16284690, 19414318, 24673584, 26934326		★★★★★ ★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	30018671		★★★★★ ★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	22139845		★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	30946927		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	25803323	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	12722795, 29525603, 30014762, 30171715, 31181609, 9365245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	BEFREE	12722795		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29525603, 30171715, 31181609		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27393618, 29487338, 30612216		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	15133865, 15753535, 18996285, 19369513, 31714673, 9928378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	31837307		★★★★★ ★☆☆☆☆ Found in Text Mining only

WNK1 (WNK lysine deficient protein kinase 1)