Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6512
Gene name	Solute carrier family 1 member 7
Gene symbol	SLC1A7
Synonyms (NCBI Gene)	AAATEAAT5
Chromosome	1
Chromosome location	1p32.3

Show/Hide all (48)

miRTarBase ID	miRNA	Experiments	Reference
MIRT528527	hsa-miR-6501-3p	PAR-CLIP	22012620
MIRT528526	hsa-miR-6736-3p	PAR-CLIP	22012620
MIRT528525	hsa-miR-4793-5p	PAR-CLIP	22012620
MIRT528524	hsa-miR-221-5p	PAR-CLIP	22012620
MIRT528523	hsa-miR-8073	PAR-CLIP	22012620
MIRT528522	hsa-miR-3064-5p	PAR-CLIP	22012620
MIRT528521	hsa-miR-6504-5p	PAR-CLIP	22012620
MIRT528520	hsa-miR-4660	PAR-CLIP	22012620
MIRT528519	hsa-miR-604	PAR-CLIP	22012620
MIRT528518	hsa-miR-6762-3p	PAR-CLIP	22012620
MIRT528517	hsa-miR-647	PAR-CLIP	22012620
MIRT528527	hsa-miR-6501-3p	PAR-CLIP	22012620
MIRT528526	hsa-miR-6736-3p	PAR-CLIP	22012620
MIRT528525	hsa-miR-4793-5p	PAR-CLIP	22012620
MIRT528524	hsa-miR-221-5p	PAR-CLIP	22012620
MIRT528523	hsa-miR-8073	PAR-CLIP	22012620
MIRT528522	hsa-miR-3064-5p	PAR-CLIP	22012620
MIRT528521	hsa-miR-6504-5p	PAR-CLIP	22012620
MIRT528520	hsa-miR-4660	PAR-CLIP	22012620
MIRT528519	hsa-miR-604	PAR-CLIP	22012620
MIRT528518	hsa-miR-6762-3p	PAR-CLIP	22012620
MIRT528517	hsa-miR-647	PAR-CLIP	22012620
MIRT1354184	hsa-miR-1245b-5p	CLIP-seq
MIRT1354185	hsa-miR-1253	CLIP-seq
MIRT1354186	hsa-miR-1254	CLIP-seq
MIRT1354187	hsa-miR-2110	CLIP-seq
MIRT1354188	hsa-miR-3116	CLIP-seq
MIRT1354189	hsa-miR-3142	CLIP-seq
MIRT1354190	hsa-miR-3150a-3p	CLIP-seq
MIRT1354191	hsa-miR-3175	CLIP-seq
MIRT1354192	hsa-miR-3689a-3p	CLIP-seq
MIRT1354193	hsa-miR-3689c	CLIP-seq
MIRT1354194	hsa-miR-4260	CLIP-seq
MIRT1354195	hsa-miR-4650-5p	CLIP-seq
MIRT1354196	hsa-miR-4728-5p	CLIP-seq
MIRT1354197	hsa-miR-4804-5p	CLIP-seq
MIRT1354198	hsa-miR-513c	CLIP-seq
MIRT1354199	hsa-miR-514b-5p	CLIP-seq
MIRT1354200	hsa-miR-518a-5p	CLIP-seq
MIRT1354201	hsa-miR-527	CLIP-seq
MIRT1354202	hsa-miR-890	CLIP-seq
MIRT1354203	hsa-miR-939	CLIP-seq
MIRT2104758	hsa-miR-1205	CLIP-seq
MIRT1354186	hsa-miR-1254	CLIP-seq
MIRT2104759	hsa-miR-2861	CLIP-seq
MIRT1354188	hsa-miR-3116	CLIP-seq
MIRT2104760	hsa-miR-3690	CLIP-seq
MIRT2104761	hsa-miR-4638-3p	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001504	Process	Neurotransmitter uptake	IDA	9108121
GO:0001504	Process	Neurotransmitter uptake	IMP	9108121
GO:0001504	Process	Neurotransmitter uptake	NAS	9108121
GO:0005313	Function	L-glutamate transmembrane transporter activity	IBA
GO:0005313	Function	L-glutamate transmembrane transporter activity	IEA
GO:0005313	Function	L-glutamate transmembrane transporter activity	TAS	9108121
GO:0005314	Function	High-affinity L-glutamate transmembrane transporter activity	TAS
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006835	Process	Dicarboxylic acid transport	TAS	9108121
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006836	Process	Neurotransmitter transport	TAS
GO:0008068	Function	Extracellularly glutamate-gated chloride channel activity	ISS
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IBA
GO:0015293	Function	Symporter activity	IEA
GO:0015501	Function	Glutamate:sodium symporter activity	IBA
GO:0015501	Function	Glutamate:sodium symporter activity	IDA	9108121
GO:0015501	Function	Glutamate:sodium symporter activity	IEA
GO:0015804	Process	Neutral amino acid transport	IEA
GO:0015813	Process	L-glutamate transmembrane transport	IBA
GO:0015813	Process	L-glutamate transmembrane transport	ISS
GO:0016020	Component	Membrane	IEA
GO:0045202	Component	Synapse	IEA
GO:0060079	Process	Excitatory postsynaptic potential	IEA
GO:0097060	Component	Synaptic membrane	IEA
GO:0098657	Process	Import into cell	IEA
GO:0098794	Component	Postsynapse	IEA
GO:1902476	Process	Chloride transmembrane transport	ISS

MIM	HGNC	e!Ensembl
604471	10945	ENSG00000162383

O00341

Protein name

Excitatory amino acid transporter 5 (Retinal glutamate transporter) (Solute carrier family 1 member 7)

Protein function

Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate. Functions as a symporter that transports one amino acid molecule together with two or three Na(+) ions and one p

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00375	SDF	19 → 476	Sodium:dicarboxylate symporter family	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed primarily in retina. Detectable in liver, heart, muscle and brain. {ECO:0000269|PubMed:9108121}.

Sequence

MVPHAILARGRDVCRRNGLLILSVLSVIVGCLLGFFLRTRRLSPQEISYFQFPGELLMRM
LKMMILPLVVSSLMSGLASLDAKTSSRLGVLTVAYYLWTTFMAVIVGIFMVSIIHPGSAA
QKETTEQSGKPIMSSADALLDLIRNMFPANLVEATFKQYRTKTTPVVKSPKVAPEEAPPR
RILIYGVQEENGSHVQNFALDLTPPPEVVYKSEPGTSDGMNVLGIVFFSATMGIMLGRMG
DSGAPLVSFCQCLNESVMKIVAVAVWYFPFGIVFLIAGKILEMDDPRAVGKKLGFYSVTV
VCGLVLHGLFILPLLYFFITKKNPIVFIRGILQALLIALATSSSSATLPITFKCLLENNH
IDRRIARFVLPVGATINMDGTALYEAVAAIFIAQVNNYELDFGQIITISITATAASIGAA
GIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWALDRFRTMINVLGDALAAGIMAHICRKD
FARDTGTEKLLPCETKPVSLQEIVAAQQNGCVKSVAEASELTLGPTCPHHVPVQVEQDEE
LPAASLNHCTIQISELETNV

Sequence length

560

Interactions

View interactions

	KEGG		Reactome
	Synaptic vesicle cycle Glutamatergic synapse		Glutamate Neurotransmitter Release Cycle Transport of inorganic cations/anions and amino acids/oligopeptides

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (11)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma of lung	Lung carcinoma	BEFREE	26310313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	26310313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	31123248	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	19395279		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gaucher Disease	Gaucher disease	Pubtator	33568133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	36397361	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	26156810		★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31123248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26310313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	31123248		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLC1A7 (solute carrier family 1 member 7)