RTN4R (reticulon 4 receptor)

Gene

• Entrez ID: 65078
• Gene name: Reticulon 4 receptor
• Gene symbol: RTN4R
• Synonyms (NCBI Gene): NGR, NOGOR
• Chromosome: 22
• Chromosome location: 22q11.21
• Summary: This gene encodes the receptor for reticulon 4, oligodendrocyte myelin glycoprotein and myelin-associated glycoprotein. This receptor mediates axonal growth inhibition and may play a role in regulating axonal regeneration and plasticity in the adult centr

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT491729	hsa-miR-3186-5p	PAR-CLIP	23592263
MIRT491728	hsa-miR-6820-5p	PAR-CLIP	23592263
MIRT491727	hsa-miR-4767	PAR-CLIP	23592263
MIRT491726	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT491725	hsa-miR-663a	PAR-CLIP	23592263
MIRT491724	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT491723	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT491722	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT491720	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT491721	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT491719	hsa-miR-4651	PAR-CLIP	23592263
MIRT491718	hsa-miR-608	PAR-CLIP	23592263
MIRT491717	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT491716	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT491715	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT491729	hsa-miR-3186-5p	PAR-CLIP	23592263
MIRT491728	hsa-miR-6820-5p	PAR-CLIP	23592263
MIRT491727	hsa-miR-4767	PAR-CLIP	23592263
MIRT491726	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT491725	hsa-miR-663a	PAR-CLIP	23592263
MIRT491724	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT491723	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT491722	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT491720	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT491721	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT491719	hsa-miR-4651	PAR-CLIP	23592263
MIRT491718	hsa-miR-608	PAR-CLIP	23592263
MIRT491717	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT491716	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT491715	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT1322253	hsa-miR-10a	CLIP-seq
MIRT1322254	hsa-miR-10b	CLIP-seq
MIRT1322255	hsa-miR-1228	CLIP-seq
MIRT1322256	hsa-miR-1270	CLIP-seq
MIRT1322257	hsa-miR-1273f	CLIP-seq
MIRT1322258	hsa-miR-1293	CLIP-seq
MIRT1322259	hsa-miR-1299	CLIP-seq
MIRT1322260	hsa-miR-3064-5p	CLIP-seq
MIRT1322261	hsa-miR-30a	CLIP-seq
MIRT1322262	hsa-miR-30b	CLIP-seq
MIRT1322263	hsa-miR-30c	CLIP-seq
MIRT1322264	hsa-miR-30d	CLIP-seq
MIRT1322265	hsa-miR-30e	CLIP-seq
MIRT1322266	hsa-miR-342-5p	CLIP-seq
MIRT1322267	hsa-miR-3607-3p	CLIP-seq
MIRT1322268	hsa-miR-3663-3p	CLIP-seq
MIRT1322269	hsa-miR-3689a-3p	CLIP-seq
MIRT1322270	hsa-miR-3689c	CLIP-seq
MIRT1322271	hsa-miR-4467	CLIP-seq
MIRT1322272	hsa-miR-4483	CLIP-seq
MIRT1322273	hsa-miR-4632	CLIP-seq
MIRT1322274	hsa-miR-4663	CLIP-seq
MIRT1322275	hsa-miR-4664-5p	CLIP-seq
MIRT1322276	hsa-miR-4683	CLIP-seq
MIRT1322277	hsa-miR-4728-5p	CLIP-seq
MIRT1322278	hsa-miR-4782-5p	CLIP-seq
MIRT1322279	hsa-miR-495	CLIP-seq
MIRT1322280	hsa-miR-516b	CLIP-seq
MIRT1322281	hsa-miR-604	CLIP-seq
MIRT1322282	hsa-miR-620	CLIP-seq
MIRT1322283	hsa-miR-647	CLIP-seq
MIRT1322284	hsa-miR-875-3p	CLIP-seq
MIRT2393949	hsa-miR-1908	CLIP-seq
MIRT2393950	hsa-miR-663	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	20463223, 20697954, 32296183
GO:0005783	Component	Endoplasmic reticulum	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS
GO:0007166	Process	Cell surface receptor signaling pathway	ISS
GO:0007409	Process	Axonogenesis	IEA
GO:0008201	Function	Heparin binding	IEA
GO:0008201	Function	Heparin binding	ISS
GO:0008289	Function	Lipid binding	IEA
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IMP	16712417
GO:0009986	Component	Cell surface	IDA	16712417, 18411262, 20463223
GO:0009986	Component	Cell surface	IEA
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0010977	Process	Negative regulation of neuron projection development	ISS
GO:0016020	Component	Membrane	IEA
GO:0022038	Process	Corpus callosum development	IEA
GO:0022038	Process	Corpus callosum development	ISS
GO:0023041	Process	Neuronal signal transduction	IEA
GO:0023041	Process	Neuronal signal transduction	ISS
GO:0030424	Component	Axon	IEA
GO:0030425	Component	Dendrite	IEA
GO:0030426	Component	Growth cone	IEA
GO:0030517	Process	Negative regulation of axon extension	IEA
GO:0030517	Process	Negative regulation of axon extension	ISS
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IBA
GO:0035025	Process	Positive regulation of Rho protein signal transduction	IMP	16712417
GO:0035374	Function	Chondroitin sulfate binding	IEA
GO:0035374	Function	Chondroitin sulfate binding	ISS
GO:0038023	Function	Signaling receptor activity	ISS
GO:0038023	Function	Signaling receptor activity	NAS	11201742
GO:0038131	Function	Neuregulin receptor activity	IEA
GO:0038131	Function	Neuregulin receptor activity	ISS
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043005	Component	Neuron projection	ISS
GO:0043025	Component	Neuronal cell body	IEA
GO:0043025	Component	Neuronal cell body	ISS
GO:0043198	Component	Dendritic shaft	IEA
GO:0043198	Component	Dendritic shaft	ISS
GO:0043204	Component	Perikaryon	IEA
GO:0043547	Process	Positive regulation of GTPase activity	ISS
GO:0044295	Component	Axonal growth cone	IEA
GO:0044295	Component	Axonal growth cone	ISS
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS
GO:0048681	Process	Negative regulation of axon regeneration	IEA
GO:0048681	Process	Negative regulation of axon regeneration	ISS
GO:0051963	Process	Regulation of synapse assembly	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098552	Component	Side of membrane	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0150052	Process	Regulation of postsynapse assembly	IEA
GO:1905573	Function	Ganglioside GM1 binding	IBA
GO:1905573	Function	Ganglioside GM1 binding	IDA	18411262
GO:1905576	Function	Ganglioside GT1b binding	IBA
GO:1905576	Function	Ganglioside GT1b binding	IDA	18411262

Other IDs

• MIM: 605566
• HGNC: 18601
• e!Ensembl: ENSG00000040608

Protein

• UniProt ID: Q9BZR6
• Protein name: Reticulon-4 receptor (Nogo receptor) (NgR) (Nogo-66 receptor)
• Protein function: Receptor for RTN4, OMG and MAG (PubMed:12037567, PubMed:12068310, PubMed:12089450, PubMed:12426574, PubMed:12839991, PubMed:16712417, PubMed:18411262, PubMed:19052207). Functions as a receptor for the sialylated gangliosides GT1b and GM1 (PubMed
• PDB: 1OZN, 1P8T
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF13855	LRR_8	114 → 166	Leucine rich repeat	Repeat
  PF13855	LRR_8	156 → 214	Leucine rich repeat	Repeat
  PF13855	LRR_8	203 → 261	Leucine rich repeat	Repeat

• Tissue specificity: TISSUE SPECIFICITY: Widespread in the brain but highest levels in the gray matter. Low levels in heart and kidney; not expressed in oligodendrocytes (white matter). {ECO:0000269|PubMed:12694398}.
• Sequence:

  MKRASAGGSRLLAWVLWLQAWQVAAPCPGACVCYNEPKVTTSCPQQGLQAVPVGIPAASQ
  RIFLHGNRISHVPAASFRACRNLTILWLHSNVLARIDAAAFTGLALLEQLDLSDNAQLRS
  VDPATFHGLGRLHTLHLDRCGLQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGNL
  THLFLHGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNLSA
  LPTEALAPLRALQYLRLNDNPWVCDCRARPLWAWLQKFRGSSSEVPCSLPQRLAGRDLKR
  LAANDLQGCAVATGPYHPIWTGRATDEEPLGLPKCCQPDAADKASVLEPGRPASAGNALK
  GRVPPGDSPPGNGSGPRHINDSPFGTLPGSAEPPLTAVRPEGSEPPGFPTSGPRRRPGCS
  RKNRTRSHCRLGQAGSGGGGTGDSEGSGALPSLTCSLTPLGLALVLWTVLGPC

• Sequence length: 473

Pathways

Reactome:

Axonal growth inhibition (RHOA activation)

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RTN4R-related disorder	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Uncertain significance	ClinVar CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet CTD, ClinVar, Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia, susceptibility to	risk factor	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	22590653		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	21338646		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	27339102		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	26083872		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	21681431		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	28892071	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	28892071		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	27112568	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	31649250		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31649250	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	30688263, 31629859		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31169192		★☆☆☆☆ Found in Text Mining only
Chronic rhinosinusitis with nasal polyps	Rhinosinusitis With Nasal Polyps	BEFREE	29754498		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	30843154		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	28903530		★☆☆☆☆ Found in Text Mining only
Delusions	Delusions	HPO_DG			★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	28892071	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30144478		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	36357677	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28656312		★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	24321711	Associate	★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	20468067, 20957646, 22104011, 23754655, 24531928		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29603739		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	31649250	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29603739, 31649250		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15312170, 31649250	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29339208		★☆☆☆☆ Found in Text Mining only
Hallucinations	Hallucinations	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ichthyosis, X-Linked	Ichthyosis	BEFREE	30125801		★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28880879, 31169193		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27650541		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28965123	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	28965123		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28901442		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	11062439		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	BEFREE	31649250		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	27991698		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20119635, 21338646, 21681431, 31847931		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28792792		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	18394723, 22544872, 28827698		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis, Relapsing-Remitting	Multiple Sclerosis	BEFREE	27728768		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29327067		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	18836295, 20119635, 21338646, 21681431, 21763734, 22590653, 23046752, 23206754, 23488787, 28236246, 28860749, 29110838, 30655764, 31820302, 31847931		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	16452662		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	28604784		★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	24321711, 28139055		★☆☆☆☆ Found in Text Mining only
Optic Neuritis	Optic Neuritis	BEFREE	28105588		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	29662195		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	20957646, 26254004, 28603490		★☆☆☆☆ Found in Text Mining only
Primary central nervous system lymphoma	Central Nervous System Lymphoma	BEFREE	31118164		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	24321711, 28139055		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	24321711	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	15532024, 16897606, 18043741, 19052207, 21377214, 23369871, 28892071		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	LHGDN	15532024, 18043741, 19052207		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	UNIPROT_DG	15532024, 19052207, 28892071		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	Pubtator	24321711, 28892071	Associate	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	HPO_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Schizophrenia	Schizophrenia	CTD_human_DG			★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Small cell carcinoma of lung	Lung carcinoma	BEFREE	29110838		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	20524398		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35886008	Associate	★☆☆☆☆ Found in Text Mining only
Steroid Sulfatase Deficiency Disease	Steroid Sulfatase Deficiency Disease	BEFREE	30125801		★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	26746987		★☆☆☆☆ Found in Text Mining only