SLC1A2 (solute carrier family 1 member 2)

Gene

• Entrez ID: 6506
• Gene name: Solute carrier family 1 member 2
• Gene symbol: SLC1A2
• Synonyms (NCBI Gene): DEE41, EAAT2, EIEE41, GLT-1, GLT1, HBGT
• Chromosome: 11
• Chromosome location: 11p13
• Summary: This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Gl

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs781379291	G>A,C	Likely-pathogenic	Missense variant, coding sequence variant, intron variant
rs886037942	C>G,T	Pathogenic	Missense variant, coding sequence variant
rs886037943	A>G	Pathogenic	Missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT675489	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT675488	hsa-miR-3176	HITS-CLIP	23313552
MIRT675487	hsa-miR-3922-3p	HITS-CLIP	23313552
MIRT675486	hsa-miR-564	HITS-CLIP	23313552
MIRT675485	hsa-miR-4743-5p	HITS-CLIP	23313552
MIRT675484	hsa-miR-4284	HITS-CLIP	23313552
MIRT675483	hsa-miR-24-3p	HITS-CLIP	23313552
MIRT649047	hsa-miR-7977	HITS-CLIP	23313552
MIRT649058	hsa-miR-15a-3p	HITS-CLIP	23824327
MIRT649057	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT649056	hsa-miR-1908-5p	HITS-CLIP	23824327
MIRT649055	hsa-miR-663a	HITS-CLIP	23824327
MIRT649054	hsa-miR-6787-5p	HITS-CLIP	23824327
MIRT675484	hsa-miR-4284	HITS-CLIP	23824327
MIRT675483	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT649053	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT649052	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT649051	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT649050	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT649049	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT649048	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT649047	hsa-miR-7977	HITS-CLIP	23824327
MIRT649046	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT649045	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT649044	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT649043	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT649042	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT649041	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT649040	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT649039	hsa-miR-3689c	HITS-CLIP	23824327
MIRT649038	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT649037	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT649036	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT649035	hsa-miR-3122	HITS-CLIP	23824327
MIRT649034	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT649033	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT649032	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT649058	hsa-miR-15a-3p	HITS-CLIP	23824327
MIRT649057	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT649056	hsa-miR-1908-5p	HITS-CLIP	23824327
MIRT649055	hsa-miR-663a	HITS-CLIP	23824327
MIRT649054	hsa-miR-6787-5p	HITS-CLIP	23824327
MIRT675484	hsa-miR-4284	HITS-CLIP	23824327
MIRT675483	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT649053	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT649052	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT649051	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT649050	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT649049	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT649048	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT649047	hsa-miR-7977	HITS-CLIP	23824327
MIRT649046	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT649045	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT649044	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT649043	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT649042	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT649041	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT649040	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT649039	hsa-miR-3689c	HITS-CLIP	23824327
MIRT649038	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT649037	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT649036	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT649035	hsa-miR-3122	HITS-CLIP	23824327
MIRT649034	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT649033	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT649032	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT649058	hsa-miR-15a-3p	HITS-CLIP	23824327
MIRT649057	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT675489	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT675488	hsa-miR-3176	HITS-CLIP	23824327
MIRT675487	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT675486	hsa-miR-564	HITS-CLIP	23824327
MIRT675485	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT649056	hsa-miR-1908-5p	HITS-CLIP	23824327
MIRT649055	hsa-miR-663a	HITS-CLIP	23824327
MIRT649054	hsa-miR-6787-5p	HITS-CLIP	23824327
MIRT675484	hsa-miR-4284	HITS-CLIP	23824327
MIRT675483	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT649053	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT649052	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT649051	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT649050	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT649049	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT649048	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT649047	hsa-miR-7977	HITS-CLIP	23824327
MIRT649046	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT649045	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT649044	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT649043	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT649042	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT649041	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT649040	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT649039	hsa-miR-3689c	HITS-CLIP	23824327
MIRT649038	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT649037	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT649036	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT649035	hsa-miR-3122	HITS-CLIP	23824327
MIRT649034	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT649033	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT649032	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT649058	hsa-miR-15a-3p	HITS-CLIP	23824327
MIRT649057	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT649056	hsa-miR-1908-5p	HITS-CLIP	23824327
MIRT649055	hsa-miR-663a	HITS-CLIP	23824327
MIRT649054	hsa-miR-6787-5p	HITS-CLIP	23824327
MIRT649053	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT649052	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT649051	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT649050	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT649049	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT649048	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT649047	hsa-miR-7977	HITS-CLIP	23824327
MIRT649046	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT649045	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT649044	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT649043	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT649042	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT649041	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT649040	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT649039	hsa-miR-3689c	HITS-CLIP	23824327
MIRT649038	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT649037	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT649036	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT649035	hsa-miR-3122	HITS-CLIP	23824327
MIRT649034	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT649033	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT649032	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT649031	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT649030	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT649029	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT649028	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT649027	hsa-miR-1910-5p	HITS-CLIP	23824327
MIRT649026	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT649025	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT649024	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT495271	hsa-miR-497-3p	PAR-CLIP	22291592
MIRT495270	hsa-miR-6776-3p	PAR-CLIP	22291592
MIRT495268	hsa-miR-1324	PAR-CLIP	22291592
MIRT495271	hsa-miR-497-3p	PAR-CLIP	23708386
MIRT495270	hsa-miR-6776-3p	PAR-CLIP	23708386
MIRT495268	hsa-miR-1324	PAR-CLIP	23708386
MIRT675489	hsa-miR-3190-5p	HITS-CLIP	23313552
MIRT675488	hsa-miR-3176	HITS-CLIP	23313552
MIRT675487	hsa-miR-3922-3p	HITS-CLIP	23313552
MIRT675486	hsa-miR-564	HITS-CLIP	23313552
MIRT675485	hsa-miR-4743-5p	HITS-CLIP	23313552
MIRT675484	hsa-miR-4284	HITS-CLIP	23313552
MIRT675483	hsa-miR-24-3p	HITS-CLIP	23313552
MIRT649047	hsa-miR-7977	HITS-CLIP	23313552
MIRT649058	hsa-miR-15a-3p	HITS-CLIP	23824327
MIRT649057	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT649056	hsa-miR-1908-5p	HITS-CLIP	23824327
MIRT649055	hsa-miR-663a	HITS-CLIP	23824327
MIRT649054	hsa-miR-6787-5p	HITS-CLIP	23824327
MIRT675484	hsa-miR-4284	HITS-CLIP	23824327
MIRT675483	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT649053	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT649052	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT649051	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT649050	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT649049	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT649048	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT649047	hsa-miR-7977	HITS-CLIP	23824327
MIRT649046	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT649045	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT649044	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT649043	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT649042	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT649041	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT649040	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT649039	hsa-miR-3689c	HITS-CLIP	23824327
MIRT649038	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT649037	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT649036	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT649035	hsa-miR-3122	HITS-CLIP	23824327
MIRT649034	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT649033	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT649032	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT649058	hsa-miR-15a-3p	HITS-CLIP	23824327
MIRT649057	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT649056	hsa-miR-1908-5p	HITS-CLIP	23824327
MIRT649055	hsa-miR-663a	HITS-CLIP	23824327
MIRT649054	hsa-miR-6787-5p	HITS-CLIP	23824327
MIRT675484	hsa-miR-4284	HITS-CLIP	23824327
MIRT675483	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT649053	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT649052	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT649051	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT649050	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT649049	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT649048	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT649047	hsa-miR-7977	HITS-CLIP	23824327
MIRT649046	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT649045	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT649044	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT649043	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT649042	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT649041	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT649040	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT649039	hsa-miR-3689c	HITS-CLIP	23824327
MIRT649038	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT649037	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT649036	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT649035	hsa-miR-3122	HITS-CLIP	23824327
MIRT649034	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT649033	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT649032	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT649058	hsa-miR-15a-3p	HITS-CLIP	23824327
MIRT649057	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT675489	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT675488	hsa-miR-3176	HITS-CLIP	23824327
MIRT675487	hsa-miR-3922-3p	HITS-CLIP	23824327
MIRT675486	hsa-miR-564	HITS-CLIP	23824327
MIRT675485	hsa-miR-4743-5p	HITS-CLIP	23824327
MIRT649056	hsa-miR-1908-5p	HITS-CLIP	23824327
MIRT649055	hsa-miR-663a	HITS-CLIP	23824327
MIRT649054	hsa-miR-6787-5p	HITS-CLIP	23824327
MIRT675484	hsa-miR-4284	HITS-CLIP	23824327
MIRT675483	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT649053	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT649052	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT649051	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT649050	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT649049	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT649048	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT649047	hsa-miR-7977	HITS-CLIP	23824327
MIRT649046	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT649045	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT649044	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT649043	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT649042	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT649041	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT649040	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT649039	hsa-miR-3689c	HITS-CLIP	23824327
MIRT649038	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT649037	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT649036	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT649035	hsa-miR-3122	HITS-CLIP	23824327
MIRT649034	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT649033	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT649032	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT649058	hsa-miR-15a-3p	HITS-CLIP	23824327
MIRT649057	hsa-miR-383-3p	HITS-CLIP	23824327
MIRT649056	hsa-miR-1908-5p	HITS-CLIP	23824327
MIRT649055	hsa-miR-663a	HITS-CLIP	23824327
MIRT649054	hsa-miR-6787-5p	HITS-CLIP	23824327
MIRT649053	hsa-miR-7106-5p	HITS-CLIP	23824327
MIRT649052	hsa-miR-149-3p	HITS-CLIP	23824327
MIRT649051	hsa-miR-4728-5p	HITS-CLIP	23824327
MIRT649050	hsa-miR-6785-5p	HITS-CLIP	23824327
MIRT649049	hsa-miR-6883-5p	HITS-CLIP	23824327
MIRT649048	hsa-miR-6799-5p	HITS-CLIP	23824327
MIRT649047	hsa-miR-7977	HITS-CLIP	23824327
MIRT649046	hsa-miR-30c-1-3p	HITS-CLIP	23824327
MIRT649045	hsa-miR-30c-2-3p	HITS-CLIP	23824327
MIRT649044	hsa-miR-6788-5p	HITS-CLIP	23824327
MIRT649043	hsa-miR-1273h-5p	HITS-CLIP	23824327
MIRT649042	hsa-miR-30b-3p	HITS-CLIP	23824327
MIRT649041	hsa-miR-3689a-3p	HITS-CLIP	23824327
MIRT649040	hsa-miR-3689b-3p	HITS-CLIP	23824327
MIRT649039	hsa-miR-3689c	HITS-CLIP	23824327
MIRT649038	hsa-miR-6779-5p	HITS-CLIP	23824327
MIRT649037	hsa-miR-6780a-5p	HITS-CLIP	23824327
MIRT649036	hsa-miR-450a-1-3p	HITS-CLIP	23824327
MIRT649035	hsa-miR-3122	HITS-CLIP	23824327
MIRT649034	hsa-miR-3913-5p	HITS-CLIP	23824327
MIRT649033	hsa-miR-887-5p	HITS-CLIP	23824327
MIRT649032	hsa-miR-6513-5p	HITS-CLIP	23824327
MIRT649031	hsa-miR-548as-3p	HITS-CLIP	23824327
MIRT649030	hsa-miR-500a-5p	HITS-CLIP	23824327
MIRT649029	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT649028	hsa-miR-455-3p	HITS-CLIP	23824327
MIRT649027	hsa-miR-1910-5p	HITS-CLIP	23824327
MIRT649026	hsa-miR-30a-3p	HITS-CLIP	23824327
MIRT649025	hsa-miR-30d-3p	HITS-CLIP	23824327
MIRT649024	hsa-miR-30e-3p	HITS-CLIP	23824327
MIRT495271	hsa-miR-497-3p	PAR-CLIP	22291592
MIRT495270	hsa-miR-6776-3p	PAR-CLIP	22291592
MIRT495268	hsa-miR-1324	PAR-CLIP	22291592
MIRT495271	hsa-miR-497-3p	PAR-CLIP	23708386
MIRT495270	hsa-miR-6776-3p	PAR-CLIP	23708386
MIRT495268	hsa-miR-1324	PAR-CLIP	23708386
MIRT1353904	hsa-miR-1184	CLIP-seq
MIRT1353905	hsa-miR-1205	CLIP-seq
MIRT1353906	hsa-miR-1206	CLIP-seq
MIRT1353907	hsa-miR-1224-5p	CLIP-seq
MIRT1353908	hsa-miR-1252	CLIP-seq
MIRT1353909	hsa-miR-1253	CLIP-seq
MIRT1353910	hsa-miR-1270	CLIP-seq
MIRT1353911	hsa-miR-1275	CLIP-seq
MIRT1353912	hsa-miR-1301	CLIP-seq
MIRT1353913	hsa-miR-1305	CLIP-seq
MIRT1353914	hsa-miR-137	CLIP-seq
MIRT1353915	hsa-miR-139-5p	CLIP-seq
MIRT1353916	hsa-miR-140-5p	CLIP-seq
MIRT1353917	hsa-miR-186	CLIP-seq
MIRT1353918	hsa-miR-194	CLIP-seq
MIRT1353919	hsa-miR-2114	CLIP-seq
MIRT1353920	hsa-miR-216a	CLIP-seq
MIRT1353921	hsa-miR-216b	CLIP-seq
MIRT1353922	hsa-miR-25	CLIP-seq
MIRT1353923	hsa-miR-27a	CLIP-seq
MIRT1353924	hsa-miR-27b	CLIP-seq
MIRT1353925	hsa-miR-3119	CLIP-seq
MIRT1353926	hsa-miR-3120-5p	CLIP-seq
MIRT1353927	hsa-miR-3121-3p	CLIP-seq
MIRT1353928	hsa-miR-3133	CLIP-seq
MIRT1353929	hsa-miR-3158-5p	CLIP-seq
MIRT1353930	hsa-miR-3165	CLIP-seq
MIRT1353931	hsa-miR-3180-5p	CLIP-seq
MIRT1353932	hsa-miR-3188	CLIP-seq
MIRT1353933	hsa-miR-3190	CLIP-seq
MIRT1353934	hsa-miR-32	CLIP-seq
MIRT1353935	hsa-miR-3202	CLIP-seq
MIRT1353936	hsa-miR-320e	CLIP-seq
MIRT1353937	hsa-miR-338-5p	CLIP-seq
MIRT1353938	hsa-miR-3622b-5p	CLIP-seq
MIRT1353939	hsa-miR-363	CLIP-seq
MIRT1353940	hsa-miR-3664-5p	CLIP-seq
MIRT1353941	hsa-miR-367	CLIP-seq
MIRT1353942	hsa-miR-3680	CLIP-seq
MIRT1353943	hsa-miR-3682-5p	CLIP-seq
MIRT1353944	hsa-miR-3692	CLIP-seq
MIRT1353945	hsa-miR-380	CLIP-seq
MIRT1353946	hsa-miR-3919	CLIP-seq
MIRT1353947	hsa-miR-3925-3p	CLIP-seq
MIRT1353948	hsa-miR-3929	CLIP-seq
MIRT1353949	hsa-miR-421	CLIP-seq
MIRT1353950	hsa-miR-4271	CLIP-seq
MIRT1353951	hsa-miR-4311	CLIP-seq
MIRT1353952	hsa-miR-4329	CLIP-seq
MIRT1353953	hsa-miR-4419b	CLIP-seq
MIRT1353954	hsa-miR-4432	CLIP-seq
MIRT1353955	hsa-miR-4434	CLIP-seq
MIRT1353956	hsa-miR-4438	CLIP-seq
MIRT1353957	hsa-miR-4478	CLIP-seq
MIRT1353958	hsa-miR-4495	CLIP-seq
MIRT1353959	hsa-miR-4516	CLIP-seq
MIRT1353960	hsa-miR-451b	CLIP-seq
MIRT1353961	hsa-miR-4522	CLIP-seq
MIRT1353962	hsa-miR-4530	CLIP-seq
MIRT1353963	hsa-miR-4531	CLIP-seq
MIRT1353964	hsa-miR-4533	CLIP-seq
MIRT1353965	hsa-miR-455-5p	CLIP-seq
MIRT1353966	hsa-miR-4640-5p	CLIP-seq
MIRT1353967	hsa-miR-4645-5p	CLIP-seq
MIRT1353968	hsa-miR-4660	CLIP-seq
MIRT1353969	hsa-miR-4662a-5p	CLIP-seq
MIRT1353970	hsa-miR-4665-5p	CLIP-seq
MIRT1353971	hsa-miR-4670-3p	CLIP-seq
MIRT1353972	hsa-miR-4673	CLIP-seq
MIRT1353973	hsa-miR-4676-5p	CLIP-seq
MIRT1353974	hsa-miR-4687-3p	CLIP-seq
MIRT1353975	hsa-miR-4696	CLIP-seq
MIRT1353976	hsa-miR-4718	CLIP-seq
MIRT1353977	hsa-miR-4724-3p	CLIP-seq
MIRT1353978	hsa-miR-4725-3p	CLIP-seq
MIRT1353979	hsa-miR-4726-5p	CLIP-seq
MIRT1353980	hsa-miR-4738-3p	CLIP-seq
MIRT1353981	hsa-miR-4749-3p	CLIP-seq
MIRT1353982	hsa-miR-4751	CLIP-seq
MIRT1353983	hsa-miR-4755-3p	CLIP-seq
MIRT1353984	hsa-miR-4756-3p	CLIP-seq
MIRT1353985	hsa-miR-4768-3p	CLIP-seq
MIRT1353986	hsa-miR-4777-5p	CLIP-seq
MIRT1353987	hsa-miR-4803	CLIP-seq
MIRT1353988	hsa-miR-485-5p	CLIP-seq
MIRT1353989	hsa-miR-495	CLIP-seq
MIRT1353990	hsa-miR-5047	CLIP-seq
MIRT1353991	hsa-miR-513a-5p	CLIP-seq
MIRT1353992	hsa-miR-518d-5p	CLIP-seq
MIRT1353993	hsa-miR-519b-5p	CLIP-seq
MIRT1353994	hsa-miR-519c-5p	CLIP-seq
MIRT1353995	hsa-miR-520a-5p	CLIP-seq
MIRT1353996	hsa-miR-520c-5p	CLIP-seq
MIRT1353997	hsa-miR-525-5p	CLIP-seq
MIRT1353998	hsa-miR-526a	CLIP-seq
MIRT1353999	hsa-miR-539	CLIP-seq
MIRT1354000	hsa-miR-542-5p	CLIP-seq
MIRT1354001	hsa-miR-548an	CLIP-seq
MIRT1354002	hsa-miR-548c-3p	CLIP-seq
MIRT1354003	hsa-miR-548p	CLIP-seq
MIRT1354004	hsa-miR-550a	CLIP-seq
MIRT1354005	hsa-miR-570	CLIP-seq
MIRT1354006	hsa-miR-575	CLIP-seq
MIRT1354007	hsa-miR-579	CLIP-seq
MIRT1354008	hsa-miR-593	CLIP-seq
MIRT1354009	hsa-miR-620	CLIP-seq
MIRT1354010	hsa-miR-633	CLIP-seq
MIRT1354011	hsa-miR-634	CLIP-seq
MIRT1354012	hsa-miR-635	CLIP-seq
MIRT1354013	hsa-miR-646	CLIP-seq
MIRT1354014	hsa-miR-7	CLIP-seq
MIRT1354015	hsa-miR-766	CLIP-seq
MIRT1354016	hsa-miR-92a	CLIP-seq
MIRT1354017	hsa-miR-92b	CLIP-seq
MIRT1354018	hsa-miR-101	CLIP-seq
MIRT1354019	hsa-miR-1183	CLIP-seq
MIRT1353906	hsa-miR-1206	CLIP-seq
MIRT1354020	hsa-miR-1283	CLIP-seq
MIRT1354021	hsa-miR-1287	CLIP-seq
MIRT1354022	hsa-miR-1322	CLIP-seq
MIRT1354023	hsa-miR-144	CLIP-seq
MIRT1354024	hsa-miR-200b	CLIP-seq
MIRT1354025	hsa-miR-200c	CLIP-seq
MIRT1353919	hsa-miR-2114	CLIP-seq
MIRT1353921	hsa-miR-216b	CLIP-seq
MIRT1354026	hsa-miR-300	CLIP-seq
MIRT1354027	hsa-miR-3065-5p	CLIP-seq
MIRT1353926	hsa-miR-3120-5p	CLIP-seq
MIRT1354028	hsa-miR-3135b	CLIP-seq
MIRT1354029	hsa-miR-3145-5p	CLIP-seq
MIRT1354030	hsa-miR-3152-5p	CLIP-seq
MIRT1354031	hsa-miR-361-3p	CLIP-seq
MIRT1354032	hsa-miR-3617	CLIP-seq
MIRT1353940	hsa-miR-3664-5p	CLIP-seq
MIRT1354033	hsa-miR-3675-3p	CLIP-seq
MIRT1354034	hsa-miR-381	CLIP-seq
MIRT1353948	hsa-miR-3929	CLIP-seq
MIRT1354035	hsa-miR-3943	CLIP-seq
MIRT1354036	hsa-miR-429	CLIP-seq
MIRT1354037	hsa-miR-4293	CLIP-seq
MIRT1353952	hsa-miR-4329	CLIP-seq
MIRT1353953	hsa-miR-4419b	CLIP-seq
MIRT1353954	hsa-miR-4432	CLIP-seq
MIRT1353957	hsa-miR-4478	CLIP-seq
MIRT1354038	hsa-miR-4509	CLIP-seq
MIRT1353960	hsa-miR-451b	CLIP-seq
MIRT1353961	hsa-miR-4522	CLIP-seq
MIRT1354039	hsa-miR-4638-3p	CLIP-seq
MIRT1354040	hsa-miR-4666-3p	CLIP-seq
MIRT1354041	hsa-miR-4684-5p	CLIP-seq
MIRT1353975	hsa-miR-4696	CLIP-seq
MIRT1354042	hsa-miR-4744	CLIP-seq
MIRT1353981	hsa-miR-4749-3p	CLIP-seq
MIRT1354043	hsa-miR-4762-5p	CLIP-seq
MIRT1353985	hsa-miR-4768-3p	CLIP-seq
MIRT1354044	hsa-miR-4768-5p	CLIP-seq
MIRT1353988	hsa-miR-485-5p	CLIP-seq
MIRT1354045	hsa-miR-499a-5p	CLIP-seq
MIRT1354046	hsa-miR-508-5p	CLIP-seq
MIRT1354047	hsa-miR-513b	CLIP-seq
MIRT1354048	hsa-miR-548u	CLIP-seq
MIRT1354004	hsa-miR-550a	CLIP-seq
MIRT1354049	hsa-miR-607	CLIP-seq
MIRT1354050	hsa-miR-641	CLIP-seq
MIRT1354015	hsa-miR-766	CLIP-seq
MIRT2104697	hsa-miR-1200	CLIP-seq
MIRT2104698	hsa-miR-1229	CLIP-seq
MIRT2104699	hsa-miR-1254	CLIP-seq
MIRT2104700	hsa-miR-1290	CLIP-seq
MIRT2104701	hsa-miR-1294	CLIP-seq
MIRT1353920	hsa-miR-216a	CLIP-seq
MIRT1353921	hsa-miR-216b	CLIP-seq
MIRT2104702	hsa-miR-218	CLIP-seq
MIRT2104703	hsa-miR-3065-3p	CLIP-seq
MIRT2104704	hsa-miR-3116	CLIP-seq
MIRT2104705	hsa-miR-3155	CLIP-seq
MIRT2104706	hsa-miR-3155b	CLIP-seq
MIRT1353930	hsa-miR-3165	CLIP-seq
MIRT2104707	hsa-miR-342-3p	CLIP-seq
MIRT2104708	hsa-miR-3611	CLIP-seq
MIRT2104709	hsa-miR-3690	CLIP-seq
MIRT2104710	hsa-miR-378	CLIP-seq
MIRT2104711	hsa-miR-378b	CLIP-seq
MIRT2104712	hsa-miR-378c	CLIP-seq
MIRT2104713	hsa-miR-378d	CLIP-seq
MIRT2104714	hsa-miR-378e	CLIP-seq
MIRT2104715	hsa-miR-378f	CLIP-seq
MIRT2104716	hsa-miR-378h	CLIP-seq
MIRT2104717	hsa-miR-378i	CLIP-seq
MIRT2104718	hsa-miR-3910	CLIP-seq
MIRT2104719	hsa-miR-3922-5p	CLIP-seq
MIRT1353948	hsa-miR-3929	CLIP-seq
MIRT2104720	hsa-miR-3941	CLIP-seq
MIRT2104721	hsa-miR-422a	CLIP-seq
MIRT2104722	hsa-miR-4316	CLIP-seq
MIRT2104723	hsa-miR-4324	CLIP-seq
MIRT1353953	hsa-miR-4419b	CLIP-seq
MIRT2104724	hsa-miR-4433	CLIP-seq
MIRT2104725	hsa-miR-4459	CLIP-seq
MIRT2104726	hsa-miR-4474-5p	CLIP-seq
MIRT1353957	hsa-miR-4478	CLIP-seq
MIRT1353961	hsa-miR-4522	CLIP-seq
MIRT2104727	hsa-miR-4540	CLIP-seq
MIRT2104728	hsa-miR-466	CLIP-seq
MIRT2104729	hsa-miR-4672	CLIP-seq
MIRT2104730	hsa-miR-4682	CLIP-seq
MIRT2104731	hsa-miR-4727-5p	CLIP-seq
MIRT1353985	hsa-miR-4768-3p	CLIP-seq
MIRT2104732	hsa-miR-4769-3p	CLIP-seq
MIRT2104733	hsa-miR-4776-3p	CLIP-seq
MIRT2104734	hsa-miR-4795-3p	CLIP-seq
MIRT2104735	hsa-miR-4799-5p	CLIP-seq
MIRT2104736	hsa-miR-484	CLIP-seq
MIRT2104737	hsa-miR-544b	CLIP-seq
MIRT1354002	hsa-miR-548c-3p	CLIP-seq
MIRT2104738	hsa-miR-552	CLIP-seq
MIRT2104739	hsa-miR-554	CLIP-seq
MIRT2104740	hsa-miR-636	CLIP-seq
MIRT2104741	hsa-miR-651	CLIP-seq
MIRT2104742	hsa-miR-656	CLIP-seq
MIRT2104743	hsa-miR-661	CLIP-seq
MIRT2104744	hsa-miR-664	CLIP-seq
MIRT1353917	hsa-miR-186	CLIP-seq
MIRT1353928	hsa-miR-3133	CLIP-seq
MIRT2104745	hsa-miR-520d-5p	CLIP-seq
MIRT2104746	hsa-miR-524-5p	CLIP-seq
MIRT2329260	hsa-miR-106a	CLIP-seq
MIRT2329261	hsa-miR-106b	CLIP-seq
MIRT2329262	hsa-miR-1197	CLIP-seq
MIRT1353907	hsa-miR-1224-5p	CLIP-seq
MIRT2329263	hsa-miR-1271	CLIP-seq
MIRT2329264	hsa-miR-1272	CLIP-seq
MIRT2104700	hsa-miR-1290	CLIP-seq
MIRT2329265	hsa-miR-142-5p	CLIP-seq
MIRT2329266	hsa-miR-15a	CLIP-seq
MIRT2329267	hsa-miR-15b	CLIP-seq
MIRT2329268	hsa-miR-16	CLIP-seq
MIRT2329269	hsa-miR-17	CLIP-seq
MIRT2329270	hsa-miR-182	CLIP-seq
MIRT2329271	hsa-miR-195	CLIP-seq
MIRT2329272	hsa-miR-20a	CLIP-seq
MIRT2329273	hsa-miR-20b	CLIP-seq
MIRT1353919	hsa-miR-2114	CLIP-seq
MIRT2104702	hsa-miR-218	CLIP-seq
MIRT2329274	hsa-miR-24	CLIP-seq
MIRT1353922	hsa-miR-25	CLIP-seq
MIRT1353923	hsa-miR-27a	CLIP-seq
MIRT1353924	hsa-miR-27b	CLIP-seq
MIRT2104703	hsa-miR-3065-3p	CLIP-seq
MIRT2329275	hsa-miR-31	CLIP-seq
MIRT1353925	hsa-miR-3119	CLIP-seq
MIRT1353927	hsa-miR-3121-3p	CLIP-seq
MIRT1354029	hsa-miR-3145-5p	CLIP-seq
MIRT2329276	hsa-miR-3153	CLIP-seq
MIRT1353931	hsa-miR-3180-5p	CLIP-seq
MIRT1353932	hsa-miR-3188	CLIP-seq
MIRT1353934	hsa-miR-32	CLIP-seq
MIRT2329277	hsa-miR-329	CLIP-seq
MIRT2329278	hsa-miR-340	CLIP-seq
MIRT2329279	hsa-miR-362-3p	CLIP-seq
MIRT1353939	hsa-miR-363	CLIP-seq
MIRT1353941	hsa-miR-367	CLIP-seq
MIRT1353943	hsa-miR-3682-5p	CLIP-seq
MIRT2329280	hsa-miR-371-5p	CLIP-seq
MIRT2329281	hsa-miR-371b-5p	CLIP-seq
MIRT2329282	hsa-miR-376c	CLIP-seq
MIRT1353948	hsa-miR-3929	CLIP-seq
MIRT2329283	hsa-miR-424	CLIP-seq
MIRT2329284	hsa-miR-4252	CLIP-seq
MIRT2329285	hsa-miR-4257	CLIP-seq
MIRT1354037	hsa-miR-4293	CLIP-seq
MIRT1353951	hsa-miR-4311	CLIP-seq
MIRT1353952	hsa-miR-4329	CLIP-seq
MIRT1353953	hsa-miR-4419b	CLIP-seq
MIRT2329286	hsa-miR-4436a	CLIP-seq
MIRT2329287	hsa-miR-4470	CLIP-seq
MIRT1353957	hsa-miR-4478	CLIP-seq
MIRT2329288	hsa-miR-4668-5p	CLIP-seq
MIRT2329289	hsa-miR-4677-5p	CLIP-seq
MIRT2329290	hsa-miR-4690-3p	CLIP-seq
MIRT2329291	hsa-miR-4731-3p	CLIP-seq
MIRT2329292	hsa-miR-4743	CLIP-seq
MIRT1353982	hsa-miR-4751	CLIP-seq
MIRT2329293	hsa-miR-4760-5p	CLIP-seq
MIRT1353985	hsa-miR-4768-3p	CLIP-seq
MIRT1353986	hsa-miR-4777-5p	CLIP-seq
MIRT2329294	hsa-miR-4801	CLIP-seq
MIRT1353988	hsa-miR-485-5p	CLIP-seq
MIRT2329295	hsa-miR-497	CLIP-seq
MIRT1354046	hsa-miR-508-5p	CLIP-seq
MIRT1353991	hsa-miR-513a-5p	CLIP-seq
MIRT2329296	hsa-miR-513c	CLIP-seq
MIRT2329297	hsa-miR-514b-5p	CLIP-seq
MIRT1353992	hsa-miR-518d-5p	CLIP-seq
MIRT2329298	hsa-miR-519a	CLIP-seq
MIRT2329299	hsa-miR-519b-3p	CLIP-seq
MIRT1353993	hsa-miR-519b-5p	CLIP-seq
MIRT2329300	hsa-miR-519c-3p	CLIP-seq
MIRT1353994	hsa-miR-519c-5p	CLIP-seq
MIRT2329301	hsa-miR-519d	CLIP-seq
MIRT1353996	hsa-miR-520c-5p	CLIP-seq
MIRT1353998	hsa-miR-526a	CLIP-seq
MIRT2329302	hsa-miR-548b-3p	CLIP-seq
MIRT2104738	hsa-miR-552	CLIP-seq
MIRT1354010	hsa-miR-633	CLIP-seq
MIRT2104740	hsa-miR-636	CLIP-seq
MIRT1354015	hsa-miR-766	CLIP-seq
MIRT2329303	hsa-miR-875-3p	CLIP-seq
MIRT1354016	hsa-miR-92a	CLIP-seq
MIRT1354017	hsa-miR-92b	CLIP-seq
MIRT2329304	hsa-miR-93	CLIP-seq
MIRT2329305	hsa-miR-96	CLIP-seq
MIRT2104702	hsa-miR-218	CLIP-seq
MIRT2104740	hsa-miR-636	CLIP-seq
MIRT2459554	hsa-miR-1908	CLIP-seq
MIRT1354029	hsa-miR-3145-5p	CLIP-seq
MIRT1353930	hsa-miR-3165	CLIP-seq
MIRT2459555	hsa-miR-3656	CLIP-seq
MIRT2329284	hsa-miR-4252	CLIP-seq
MIRT1354037	hsa-miR-4293	CLIP-seq
MIRT1354046	hsa-miR-508-5p	CLIP-seq
MIRT2459556	hsa-miR-663	CLIP-seq
MIRT1354015	hsa-miR-766	CLIP-seq
MIRT2623548	hsa-miR-1273d	CLIP-seq
MIRT2623549	hsa-miR-146b-3p	CLIP-seq
MIRT2459554	hsa-miR-1908	CLIP-seq
MIRT1353926	hsa-miR-3120-5p	CLIP-seq
MIRT2623550	hsa-miR-3157-3p	CLIP-seq
MIRT1353930	hsa-miR-3165	CLIP-seq
MIRT2623551	hsa-miR-3173-5p	CLIP-seq
MIRT2459555	hsa-miR-3656	CLIP-seq
MIRT1353940	hsa-miR-3664-5p	CLIP-seq
MIRT1353954	hsa-miR-4432	CLIP-seq
MIRT2104724	hsa-miR-4433	CLIP-seq
MIRT2104725	hsa-miR-4459	CLIP-seq
MIRT2623552	hsa-miR-4502	CLIP-seq
MIRT1353960	hsa-miR-451b	CLIP-seq
MIRT1353961	hsa-miR-4522	CLIP-seq
MIRT2623553	hsa-miR-4683	CLIP-seq
MIRT1353975	hsa-miR-4696	CLIP-seq
MIRT2623554	hsa-miR-4762-3p	CLIP-seq
MIRT1353985	hsa-miR-4768-3p	CLIP-seq
MIRT2623555	hsa-miR-4786-5p	CLIP-seq
MIRT2623556	hsa-miR-4793-5p	CLIP-seq
MIRT1354002	hsa-miR-548c-3p	CLIP-seq
MIRT2459556	hsa-miR-663	CLIP-seq
MIRT1354015	hsa-miR-766	CLIP-seq
MIRT2623557	hsa-miR-874	CLIP-seq
MIRT2623548	hsa-miR-1273d	CLIP-seq
MIRT2459554	hsa-miR-1908	CLIP-seq
MIRT1353926	hsa-miR-3120-5p	CLIP-seq
MIRT1353930	hsa-miR-3165	CLIP-seq
MIRT2690917	hsa-miR-3613-3p	CLIP-seq
MIRT2459555	hsa-miR-3656	CLIP-seq
MIRT1353940	hsa-miR-3664-5p	CLIP-seq
MIRT1353954	hsa-miR-4432	CLIP-seq
MIRT2104724	hsa-miR-4433	CLIP-seq
MIRT2104725	hsa-miR-4459	CLIP-seq
MIRT1353960	hsa-miR-451b	CLIP-seq
MIRT1353961	hsa-miR-4522	CLIP-seq
MIRT2623553	hsa-miR-4683	CLIP-seq
MIRT1353975	hsa-miR-4696	CLIP-seq
MIRT1353985	hsa-miR-4768-3p	CLIP-seq
MIRT2623555	hsa-miR-4786-5p	CLIP-seq
MIRT1354002	hsa-miR-548c-3p	CLIP-seq
MIRT2459556	hsa-miR-663	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005313	Function	L-glutamate transmembrane transporter activity	IBA
GO:0005313	Function	L-glutamate transmembrane transporter activity	IDA	7521911
GO:0005313	Function	L-glutamate transmembrane transporter activity	IEA
GO:0005314	Function	High-affinity L-glutamate transmembrane transporter activity	IDA	26690923
GO:0005314	Function	High-affinity L-glutamate transmembrane transporter activity	IEA
GO:0005314	Function	High-affinity L-glutamate transmembrane transporter activity	TAS
GO:0005515	Function	Protein binding	IPI	19527721, 32814053
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IMP	15265858, 26690923
GO:0005886	Component	Plasma membrane	TAS
GO:0006750	Process	Glutathione biosynthetic process	IEA
GO:0006811	Process	Monoatomic ion transport	TAS
GO:0006836	Process	Neurotransmitter transport	IEA
GO:0006836	Process	Neurotransmitter transport	TAS
GO:0006865	Process	Amino acid transport	IEA
GO:0007268	Process	Chemical synaptic transmission	TAS	7521911
GO:0007399	Process	Nervous system development	IEA
GO:0007632	Process	Visual behavior	IEA
GO:0008509	Function	Monoatomic anion transmembrane transporter activity	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009416	Process	Response to light stimulus	IEA
GO:0009611	Process	Response to wounding	IEA
GO:0009986	Component	Cell surface	IDA	21399631
GO:0015175	Function	Neutral L-amino acid transmembrane transporter activity	IBA
GO:0015293	Function	Symporter activity	IEA
GO:0015501	Function	Glutamate:sodium symporter activity	IBA
GO:0015501	Function	Glutamate:sodium symporter activity	IDA	15265858
GO:0015501	Function	Glutamate:sodium symporter activity	IEA
GO:0015804	Process	Neutral amino acid transport	IEA
GO:0015813	Process	L-glutamate transmembrane transport	IDA	26690923
GO:0015813	Process	L-glutamate transmembrane transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	7521911
GO:0021537	Process	Telencephalon development	IEA
GO:0030424	Component	Axon	IEA
GO:0030534	Process	Adult behavior	IEA
GO:0030673	Component	Axolemma	IEA
GO:0031982	Component	Vesicle	IEA
GO:0033229	Function	Cysteine transmembrane transporter activity	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0042734	Component	Presynaptic membrane	IDA	21258616
GO:0043200	Process	Response to amino acid	IEA
GO:0044297	Component	Cell body	IEA
GO:0044297	Component	Cell body	ISS
GO:0044306	Component	Neuron projection terminus	IEA
GO:0045121	Component	Membrane raft	IDA	20193040
GO:0045121	Component	Membrane raft	IEA
GO:0045121	Component	Membrane raft	ISS	20193040
GO:0045202	Component	Synapse	IEA
GO:0046326	Process	Positive regulation of D-glucose import	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0070207	Process	Protein homotrimerization	IDA	15265858, 15483603
GO:0070633	Process	Transepithelial transport	ISS
GO:0070778	Process	L-aspartate transmembrane transport	IBA
GO:0070778	Process	L-aspartate transmembrane transport	ISS
GO:0070779	Process	D-aspartate import across plasma membrane	IDA	7521911
GO:0071314	Process	Cellular response to cocaine	IEA
GO:0097449	Component	Astrocyte projection	IEA
GO:0097449	Component	Astrocyte projection	ISS
GO:0098656	Process	Monoatomic anion transmembrane transport	IEA
GO:0098657	Process	Import into cell	IEA
GO:0098712	Process	L-glutamate import across plasma membrane	IBA
GO:0098712	Process	L-glutamate import across plasma membrane	IDA	7521911, 15265858, 26690923
GO:0098712	Process	L-glutamate import across plasma membrane	IEA
GO:0098712	Process	L-glutamate import across plasma membrane	IGI	20193040
GO:0098796	Component	Membrane protein complex	IDA	20193040
GO:0098796	Component	Membrane protein complex	ISS
GO:0098810	Process	Neurotransmitter reuptake	IEA
GO:0098978	Component	Glutamatergic synapse	IEA
GO:0140009	Process	L-aspartate import across plasma membrane	IDA	7521911
GO:0150104	Process	Transport across blood-brain barrier	ISS
GO:0150104	Process	Transport across blood-brain barrier	NAS	26590417, 30280653
GO:1903712	Process	Cysteine transmembrane transport	IEA

Other IDs

• MIM: 600300
• HGNC: 10940
• e!Ensembl: ENSG00000110436

Protein

• UniProt ID: P43004
• Protein name: Excitatory amino acid transporter 2 (Glutamate/aspartate transporter II) (Sodium-dependent glutamate/aspartate transporter 2) (Solute carrier family 1 member 2)
• Protein function: Sodium-dependent, high-affinity amino acid transporter that mediates the uptake of L-glutamate and also L-aspartate and D-aspartate (PubMed:14506254, PubMed:15265858, PubMed:26690923, PubMed:7521911). Functions as a symporter that transports one
• PDB: 7VR7, 7VR8, 7XR4, 7XR6
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00375	SDF	46 → 496	Sodium:dicarboxylate symporter family	Family

• Sequence:

  MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVC
  GGLLRLASPIHPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRA
  MVYYMSTTIIAAVLGVILVLAIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENL
  VQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDGM
  NVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKLVIMIMWYSPLGIACLICGKI
  IAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAGIFQAWITALG
  TASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL
  DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTS
  VNVVGDSFGAGIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYA
  AHNSVIVDECKVTLAANGKSADCSVEEEPWKREK

• Sequence length: 574

Pathways

KEGG:

Synaptic vesicle cycle
Glutamatergic synapse
Amyotrophic lateral sclerosis
Huntington disease

Reactome:

Astrocytic Glutamate-Glutamine Uptake And Metabolism
Glutamate Neurotransmitter Release Cycle
Transport of inorganic cations/anions and amino acids/oligopeptides

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Developmental and epileptic encephalopathy, 41	Likely pathogenic; Pathogenic	rs2497859234, rs2497774921, rs886037942, rs1431104151, rs2497830626, rs2497617328, rs781379291	RCV002465467 RCV002466370 RCV000240886 RCV003231066 RCV003231067 RCV003231069 RCV000505595 RCV000505637	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AMYOTROPHIC LATERAL SCLEROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOIMMUNE THYROID DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY 41	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, TYPE 2	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EPILEPSY	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESSENTIAL TREMOR	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC EARLY-ONSET EPILEPTIC ENCEPHALOPATHY	—	Disgenet, Orphanet Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SLC1A2-related disorder	Conflicting classifications of pathogenicity; Benign; Uncertain significance; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNDETERMINED EARLY-ONSET EPILEPTIC ENCEPHALOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VITILIGO	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acquired Kyphoscoliosis	Acquired Kyphoscoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	17823119		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	25785590		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander Disease	BEFREE	19129171		★☆☆☆☆ Found in Text Mining only
Alexander Disease	Alexander disease	Pubtator	31611638	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	12408226, 18326497, 20688910, 33275249, 34310962, 34800614, 39603277, 9771796	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	20193040, 21743130	Inhibit	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29374250	Stimulate	★☆☆☆☆ Found in Text Mining only
Alzheimer disease, familial, type 3	Alzheimer disease	BEFREE	11071482		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	10540035, 10653305, 11071482, 11357955, 11790392, 11818550, 12153483, 12504589, 15246112, 17823119, 19322031, 19428804, 19672971, 20152807, 21569822, 21792905, 23665075, 24753081, 25064045, 25311268, 25434487, 27206883, 28342750, 28526579, 29458024, 29777762, 30007309, 30980198, 31112137, 31338020, 8619555, 9539131, 9585360, 9593515, 9771796		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	CTD_human_DG	11723166		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	LHGDN	15048885, 16567804		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	18326497, 20508255, 30359484, 9771796	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS 1	Lateral Sclerosis	BEFREE	10321246		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis With Dementia	Amyotrophic Lateral Sclerosis With Dementia	CTD_human_DG	11723166		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Guam Form	Amyotrophic lateral sclerosis	CTD_human_DG	11723166		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	11031254, 9585360		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	20153402		★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	20153402		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11606683, 15753393		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	11606683	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	20535486		★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	20410850		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	19096215, 25406999		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	Pubtator	25406999	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Awakening Epilepsy	Epilepsy	CTD_human_DG	19853022		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	PSYGENET_DG	11850151, 23023733, 23706640, 24518437		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar disorder	Pubtator	18191109, 25406999, 26340055, 28525603, 31123248	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bipolar Disorder	Bipolar Disorder	BEFREE	23023733, 23706640, 24518437, 25406999, 28785205, 29790085		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Borderline Personality Disorder	Borderline personality disorder	BEFREE	23706640		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	27476654, 30937933	Associate	★☆☆☆☆ Found in Text Mining only
Brain Edema	Brain edema	Pubtator	24164438	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30731111		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	33099952	Inhibit	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23637631		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	23706640		★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	16651809, 30031913		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	38176931	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	BEFREE	28271401		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31611842		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	25785590		★☆☆☆☆ Found in Text Mining only
Clonic Seizures	Clonic Seizures	BEFREE	29214672		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	25589729, 30452416		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	35260124	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	23637631, 25576211		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25576211		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	23637631, 25576211	Associate	★☆☆☆☆ Found in Text Mining only
Congenital kyphoscoliosis	Congenital kyphoscoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Delirium, Dementia, Amnestic, Cognitive Disorders	Delirium, Dementia, Amnestic, Cognitive Disorders	BEFREE	27506782		★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	Pubtator	18326497	Associate	★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	29343737, 29755340		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	PSYGENET_DG	16230605, 21161710, 21779782		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	28395974, 28629384, 30261717		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder	Major depressive disorder	Pubtator	31123248	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive Disorder Major	Major depressive disorder	Pubtator	16230605	Inhibit	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	20386568	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	36804406	Associate	★☆☆☆☆ Found in Text Mining only
Developmental regression	Developmental regression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	30718926		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	CTD_human_DG	30718926		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	BEFREE	30676715		★☆☆☆☆ Found in Text Mining only
Dyskinetic syndrome	Dyskinetic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	Pubtator	36804406	Associate	★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	Pubtator	31353670	Associate	★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	10555780, 28777935		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	28777935	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	Pubtator	17868051	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	CTD_human_DG	19853022		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	23418513, 28777935, 30937933, 33621827	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	BEFREE	25064045, 28028152, 29214672, 30022509, 30360015, 30429824, 30937933, 31108086, 31158434, 31338020		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy Temporal Lobe	Temporal lobe epilepsy	Pubtator	18326497	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy, Cryptogenic	Epilepsy	CTD_human_DG	19853022		★☆☆☆☆ Found in Text Mining only
Epilepsy, Temporal Lobe	Epilepsy	BEFREE	10336123, 11834591, 15246112, 28028152, 30360015, 30450970, 31158434		★☆☆☆☆ Found in Text Mining only
Epileptic encephalopathy	Epileptic encephalopathy	GENOMICS_ENGLAND_DG	27476654		★☆☆☆☆ Found in Text Mining only
Epileptic encephalopathy	Epileptic encephalopathy	BEFREE	30937933		★☆☆☆☆ Found in Text Mining only
Epileptic encephalopathy	Epileptic encephalopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 41	Epileptic encephalopathy	CLINVAR_DG	23107647, 24214974, 28777935		★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 41	Epileptic encephalopathy	UNIPROT_DG	27476654, 28777935		★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 41	Epileptic encephalopathy	GENOMICS_ENGLAND_DG	28777935, 28915517		★☆☆☆☆ Found in Text Mining only
EPILEPTIC ENCEPHALOPATHY, EARLY INFANTILE, 41	Epileptic encephalopathy	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Essential Tremor	Tremor	BEFREE	22764253, 23596072, 23949322, 23951268, 24139280, 24532269, 26313486, 27206883, 27456607, 27624392, 27797806, 29275184		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Tremor	GWASCAT_DG	22764253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Tremor	GWASDB_DG	22764253		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Essential Tremor	Essential tremor	Pubtator	22764253, 23951268, 25391854, 27624392, 31755235	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	BEFREE	29303644		★☆☆☆☆ Found in Text Mining only
Fragile X Syndrome	Fragile X Syndrome	BEFREE	23396537		★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26047211	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	33099952	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15753393		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	18326497, 33621827	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	Pubtator	15571509	Associate	★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	9771796		★☆☆☆☆ Found in Text Mining only
Hepatic Encephalopathy	Hepatic Encephalopathy	BEFREE	10555780		★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21471434		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	11850151, 20494921, 23642110, 27179791, 31338020, 9100675		★☆☆☆☆ Found in Text Mining only
Hypersomnia	Hypersomnia	BEFREE	30416062		★☆☆☆☆ Found in Text Mining only
Hypodontia	Hypodontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoplasia of corpus callosum	Hypoplasia Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	31068830		★☆☆☆☆ Found in Text Mining only
Idiopathic generalized epilepsy	Epilepsy	BEFREE	10924870		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	16687472		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	22728822, 25589729, 30452416, 31591195		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	28777935		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intracranial Aneurysm	Intracranial aneurysm	Pubtator	37041519	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	24943094, 27837432, 31004734		★☆☆☆☆ Found in Text Mining only
Lafora Disease	Lafora Disease	BEFREE	31108086		★☆☆☆☆ Found in Text Mining only
Leukomalacia Periventricular	Periventricular leukomalacia	Pubtator	18314905	Associate	★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	BEFREE	17311320		★☆☆☆☆ Found in Text Mining only
Leukomalacia, Periventricular	Periventricular Leukomalacia	LHGDN	17311320		★☆☆☆☆ Found in Text Mining only
Lewy Body Disease	Lewy Body Disease	BEFREE	29755340		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	BEFREE	15542698		★☆☆☆☆ Found in Text Mining only
Liver Failure Acute	Liver failure	Pubtator	24164438	Associate	★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	10555780, 11746425, 24164438		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	16230605, 23415275, 23706640, 24652383, 31123248		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	25576211		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	21471434		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21471434		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	23637631, 25576211		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	25785590		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	33099952	Inhibit	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	PSYGENET_DG	16230605, 21161710, 21779782		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental Depression	Mental Depression	BEFREE	28395974, 28629384, 30261717		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mental disorders	Mental Disorders	BEFREE	29128307		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	24412224		★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	PSYGENET_DG	21779782		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mood Disorders	Mood Disorder	BEFREE	30261717		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Motor neuron atrophy	Motor neuron atrophy	BEFREE	11071482, 28732762, 29458024, 30980198		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	12153483, 21569822, 28821644, 9771796		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	9771796	Associate	★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	25576211		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	16061389		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	LHGDN	16061389		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	33297722	Inhibit	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	39223661	Associate	★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	BEFREE	28658620		★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	11606683	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11161003, 11606683, 15753393, 16964294, 21471434, 22843268, 29769580		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	17311293, 17684493, 25064045, 28271401, 29405337, 30851309		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	LHGDN	17684493		★☆☆☆☆ Found in Text Mining only
Neurocognitive Disorders	Neurocognitive Disorders	BEFREE	27506782		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	12408226, 12578975, 25406999	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	21792905, 22924507, 25972039, 31270389, 31628912, 9539131		★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	22069320		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25576211		★☆☆☆☆ Found in Text Mining only
Non-specific early-onset epileptic encephalopathy	Non-Specifi Epileptic Encephalopathy	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obsessive-Compulsive Disorder	Obsessive-Compulsive Disorder	BEFREE	30845202		★☆☆☆☆ Found in Text Mining only
Olivopontocerebellar Atrophies	Olivopontocerebellar Atrophies	BEFREE	12083339		★☆☆☆☆ Found in Text Mining only
Optic Atrophy	Optic Atrophy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglosphonic dysplasia	BEFREE	30158854, 30731111		★☆☆☆☆ Found in Text Mining only
Osteoglophonic dwarfism	Osteoglophonic dwarfism	Pubtator	38176931	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	23596072, 27206883, 29275184, 30676715, 30958793, 31338020, 31582965		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31755235, 34310962, 34800614	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	31755235	Inhibit	★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	23637631		★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	29343737, 29755340		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	25406999		★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychotic disorders	Pubtator	25406999, 35260124	Associate	★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rasmussen Syndrome	Rasmussen`s Syndrome	BEFREE	31353670		★☆☆☆☆ Found in Text Mining only
Restless Legs Syndrome	Restless Legs Syndrome	BEFREE	24424098		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	11850151, 15296513, 19660525, 19716271, 21281445, 22728822, 23356950, 24076156, 24560881, 25406999, 26057049, 26416546, 26459047, 30539765, 30915775, 31118638, 9602129		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	18191109, 21281445, 25406999, 28525603, 35260124	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	22728822, 23356950, 24076156, 24560881		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seizures	Seizures	Pubtator	11606683	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia Hereditary	Hereditary spastic paraplegia	Pubtator	9771796	Associate	★☆☆☆☆ Found in Text Mining only
Spastic Paraplegia, Hereditary	Spastic paraplegia	BEFREE	9771796		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	BEFREE	21297271, 31158434		★☆☆☆☆ Found in Text Mining only
Status Epilepticus	Status Epilepticus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29303644		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	21471434		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21471434		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	21471434, 25576211	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stroke	Stroke	Pubtator	18326497	Associate	★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous sclerosis complex	Pubtator	19912235	Associate	★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	16230605, 24652383, 31123248		★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	GWASCAT_DG	22561518, 27723757		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Vitiligo	Vitiligo	GWASDB_DG	22561518		★★☆☆☆ Found in Text Mining + Unknown/Other Associations