Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	6504
Gene name	Signaling lymphocytic activation molecule family member 1
Gene symbol	SLAMF1
Synonyms (NCBI Gene)	CD150CDw150IPO3SLAM
Chromosome	1
Chromosome location	1q23.3

Show/Hide all (58)

miRTarBase ID	miRNA	Experiments	Reference
MIRT030083	hsa-miR-26b-5p	Microarray	19088304
MIRT641305	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT641304	hsa-miR-3921	HITS-CLIP	23824327
MIRT641303	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT641302	hsa-miR-4682	HITS-CLIP	23824327
MIRT641301	hsa-miR-496	HITS-CLIP	23824327
MIRT641300	hsa-miR-4448	HITS-CLIP	23824327
MIRT641305	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT641304	hsa-miR-3921	HITS-CLIP	23824327
MIRT641303	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT641302	hsa-miR-4682	HITS-CLIP	23824327
MIRT641301	hsa-miR-496	HITS-CLIP	23824327
MIRT641300	hsa-miR-4448	HITS-CLIP	23824327
MIRT641299	hsa-miR-194-5p	HITS-CLIP	23824327
MIRT641298	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT641297	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT641296	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT641295	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT641294	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT641293	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT641292	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT641291	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT641290	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT641289	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT641288	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT641287	hsa-miR-6802-3p	HITS-CLIP	23824327
MIRT641305	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT641304	hsa-miR-3921	HITS-CLIP	23824327
MIRT641303	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT641302	hsa-miR-4682	HITS-CLIP	23824327
MIRT641301	hsa-miR-496	HITS-CLIP	23824327
MIRT641300	hsa-miR-4448	HITS-CLIP	23824327
MIRT641305	hsa-miR-3121-5p	HITS-CLIP	23824327
MIRT641304	hsa-miR-3921	HITS-CLIP	23824327
MIRT641303	hsa-miR-4653-5p	HITS-CLIP	23824327
MIRT641302	hsa-miR-4682	HITS-CLIP	23824327
MIRT641301	hsa-miR-496	HITS-CLIP	23824327
MIRT641300	hsa-miR-4448	HITS-CLIP	23824327
MIRT641299	hsa-miR-194-5p	HITS-CLIP	23824327
MIRT641298	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT641297	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT641296	hsa-miR-6865-3p	HITS-CLIP	23824327
MIRT641295	hsa-miR-3620-3p	HITS-CLIP	23824327
MIRT641294	hsa-miR-877-3p	HITS-CLIP	23824327
MIRT641293	hsa-miR-412-3p	HITS-CLIP	23824327
MIRT641292	hsa-miR-6754-3p	HITS-CLIP	23824327
MIRT641291	hsa-miR-6837-3p	HITS-CLIP	23824327
MIRT641290	hsa-miR-4778-3p	HITS-CLIP	23824327
MIRT641289	hsa-miR-2682-3p	HITS-CLIP	23824327
MIRT641288	hsa-miR-6781-3p	HITS-CLIP	23824327
MIRT641287	hsa-miR-6802-3p	HITS-CLIP	23824327
MIRT1351471	hsa-miR-1825	CLIP-seq
MIRT1351472	hsa-miR-199a-5p	CLIP-seq
MIRT1351473	hsa-miR-199b-5p	CLIP-seq
MIRT1351474	hsa-miR-323-5p	CLIP-seq
MIRT1351475	hsa-miR-4302	CLIP-seq
MIRT1351476	hsa-miR-4456	CLIP-seq
MIRT1351477	hsa-miR-876-3p	CLIP-seq

Show/Hide all (49)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IDA	10972291
GO:0001618	Function	Virus receptor activity	IEA
GO:0001779	Process	Natural killer cell differentiation	IEA
GO:0001787	Process	Natural killer cell proliferation	IEA
GO:0001818	Process	Negative regulation of cytokine production	IEA
GO:0002232	Process	Leukocyte chemotaxis involved in inflammatory response	IEA
GO:0002250	Process	Adaptive immune response	IEA
GO:0002277	Process	Myeloid dendritic cell activation involved in immune response	IDA	16317102
GO:0002376	Process	Immune system process	IEA
GO:0002725	Process	Negative regulation of T cell cytokine production	IEA
GO:0003823	Function	Antigen binding	TAS	7617038
GO:0004888	Function	Transmembrane signaling receptor activity	TAS	7617038
GO:0005515	Function	Protein binding	IPI	9774102, 10549287, 11389028, 11477068, 11806999, 11823424, 12225753, 12545174, 14674764, 15841490, 16983070, 20231852, 22048310
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IDA	10972291
GO:0005886	Component	Plasma membrane	IEA
GO:0006909	Process	Phagocytosis	IEA
GO:0006955	Process	Immune response	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	7617038
GO:0009897	Component	External side of plasma membrane	IBA
GO:0009897	Component	External side of plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010759	Process	Positive regulation of macrophage chemotaxis	IEA
GO:0016020	Component	Membrane	IEA
GO:0031338	Process	Regulation of vesicle fusion	IEA
GO:0032689	Process	Negative regulation of type II interferon production	IEA
GO:0032695	Process	Negative regulation of interleukin-12 production	IDA	16317102
GO:0032715	Process	Negative regulation of interleukin-6 production	IDA	16317102
GO:0032720	Process	Negative regulation of tumor necrosis factor production	IDA	16317102
GO:0032729	Process	Positive regulation of type II interferon production	IEA
GO:0038023	Function	Signaling receptor activity	IBA
GO:0038023	Function	Signaling receptor activity	IEA
GO:0042104	Process	Positive regulation of activated T cell proliferation	IEA
GO:0042169	Function	SH2 domain binding	IDA	9774102
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	21217702, 21982860
GO:0045087	Process	Innate immune response	IEA
GO:0045321	Process	Leukocyte activation	IEA
GO:0045335	Component	Phagocytic vesicle	IEA
GO:0046330	Process	Positive regulation of JNK cascade	IDA	20231852
GO:0046649	Process	Lymphocyte activation	IEA
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0070062	Component	Extracellular exosome	HDA	20458337
GO:0070374	Process	Positive regulation of ERK1 and ERK2 cascade	IDA	20231852
GO:2000349	Process	Negative regulation of CD40 signaling pathway	IDA	16317102
GO:2000510	Process	Positive regulation of dendritic cell chemotaxis	IEA
GO:2000556	Process	Positive regulation of T-helper 1 cell cytokine production	IEA

MIM	HGNC	e!Ensembl
603492	10903	ENSG00000117090

Q13291

Protein name

Signaling lymphocytic activation molecule (CDw150) (IPO-3) (SLAM family member 1) (CD antigen CD150)

Protein function

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and

PDB

1D4T , 1D4W , 1I3Z , 1KA6 , 1KA7 , 1M27

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06214	SLAM	1 → 125	Signaling lymphocytic activation molecule (SLAM) protein	Family

Tissue specificity

TISSUE SPECIFICITY: Constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation (PubMed:7617038). Activated B-cells express isoform 1

Sequence

MDPKGLLSLTFVLFLSLAFGASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSI
HIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYKFYLENLTLGIRESRKEDEGWYLM
TLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAYSWSEKA
GTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPWAV
YAGLLGGVIMILIMVVILQLRRRGKTNHYQTTVEKKSLTIYAQVQKPGPLQKKLDSFPAQ
DPCTTIYVAATEPVPESVQETNSITVYASVTLPES

Sequence length

335

Interactions

View interactions

	KEGG
	Virion - Ebolavirus, Lyssavirus and Morbillivirus Measles

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT REFRACTORY SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (69)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Astrocytoma	Astrocytoma	Pubtator	25710480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	15589166, 18482989, 21094032, 23731618, 24373350, 29729453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	33987447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	27854550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27128794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26317644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central Nervous System Neoplasms	BEFREE	25710480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Neoplasms	Central nervous system neoplasm	Pubtator	25710480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	32746852, 36802116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	20923685, 22194822, 28982149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33295628, 34298022	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34467243	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33295628	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32983115	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	22277902, 31332162		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eczema	Eczema	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	32983115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	36096644	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatigue Syndrome Chronic	Fatigue syndrome	Pubtator	26032326	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	25710480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	25710480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	25710480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25710480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25710480	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	BEFREE	21278219		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graft-vs-Host Disease	Graft-Vs-Host Disease	BEFREE	30972163		★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	33987447	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	27854550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	32983115	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	23913184, 30616923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypogammaglobulinemia	Hypogammaglobulinemia	BEFREE	15761493		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33295628	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	BEFREE	11698444		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	15356162	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leprosy Lepromatous	Leprosy	Pubtator	11698444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27081035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	21278219, 29020082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	10225817, 23956418, 33828555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	29020082, 35603218	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	21278219, 29020082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	20146065, 20810499, 21278219, 22184727, 26314831, 28076903, 29020082, 30058241, 30415085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	21278219, 29020082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	15746063		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	20220060	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	10607564, 11034354, 11823424, 22048771	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	12629654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27128794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26317644		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	26682762, 29622725		★★★★★ ★☆☆☆☆ Found in Text Mining only
Miscarriage	Miscarriage	BEFREE	15288189		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	23731618, 28744161, 30410677		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	26287276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	37072216	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myasthenia Gravis	Myasthenia Gravis	BEFREE	24719132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myasthenia Gravis	Myasthenia gravis	Pubtator	24719132	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	21948475		★★★★★ ★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	16775330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nonorganic psychosis	Nonorganic Psychosis	BEFREE	29796850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	34461858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psychotic Disorders	Psychosis	BEFREE	29796850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	36655999	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	9893194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	Pubtator	25142143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22194822		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	11168816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	11698444	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	31671219		★★★★★ ★☆☆☆☆ Found in Text Mining only
X-Linked Lymphoproliferative Disorder	Lymphoproliferative Syndrome, X-Linked	BEFREE	10549287, 10607564, 10694488, 10975798, 11034354, 11509608, 11823424, 12629654, 12766168, 14523387, 15169881, 15661030, 17201683, 20146065, 24113228, 28049627 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLAMF1 (signaling lymphocytic activation molecule family member 1)