Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	64968
Gene name	Mitochondrial ribosomal protein S6
Gene symbol	MRPS6
Synonyms (NCBI Gene)	C21orf101MRP-S6RPMS6S6mtbS6m
Chromosome	21
Chromosome location	21q22.11
Summary	Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% prot

Show/Hide all (93)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050858	hsa-miR-17-5p	CLASH	23622248
MIRT1160477	hsa-miR-1237	CLIP-seq
MIRT1160478	hsa-miR-1248	CLIP-seq
MIRT1160479	hsa-miR-142-5p	CLIP-seq
MIRT1160480	hsa-miR-1915	CLIP-seq
MIRT1160481	hsa-miR-202	CLIP-seq
MIRT1160482	hsa-miR-330-3p	CLIP-seq
MIRT1160483	hsa-miR-340	CLIP-seq
MIRT1160484	hsa-miR-3611	CLIP-seq
MIRT1160485	hsa-miR-3692	CLIP-seq
MIRT1160486	hsa-miR-369-3p	CLIP-seq
MIRT1160487	hsa-miR-374a	CLIP-seq
MIRT1160488	hsa-miR-374b	CLIP-seq
MIRT1160489	hsa-miR-374c	CLIP-seq
MIRT1160490	hsa-miR-382	CLIP-seq
MIRT1160491	hsa-miR-3926	CLIP-seq
MIRT1160492	hsa-miR-3929	CLIP-seq
MIRT1160493	hsa-miR-3941	CLIP-seq
MIRT1160494	hsa-miR-409-5p	CLIP-seq
MIRT1160495	hsa-miR-410	CLIP-seq
MIRT1160496	hsa-miR-4419b	CLIP-seq
MIRT1160497	hsa-miR-4438	CLIP-seq
MIRT1160498	hsa-miR-4459	CLIP-seq
MIRT1160499	hsa-miR-4478	CLIP-seq
MIRT1160500	hsa-miR-4484	CLIP-seq
MIRT1160501	hsa-miR-4643	CLIP-seq
MIRT1160502	hsa-miR-466	CLIP-seq
MIRT1160503	hsa-miR-4661-5p	CLIP-seq
MIRT1160504	hsa-miR-4672	CLIP-seq
MIRT1160505	hsa-miR-4678	CLIP-seq
MIRT1160506	hsa-miR-4717-3p	CLIP-seq
MIRT1160507	hsa-miR-4726-3p	CLIP-seq
MIRT1160508	hsa-miR-4753-5p	CLIP-seq
MIRT1160509	hsa-miR-4772-3p	CLIP-seq
MIRT1160510	hsa-miR-518a-5p	CLIP-seq
MIRT1160511	hsa-miR-527	CLIP-seq
MIRT1160512	hsa-miR-548an	CLIP-seq
MIRT1160513	hsa-miR-548p	CLIP-seq
MIRT1160514	hsa-miR-655	CLIP-seq
MIRT1160515	hsa-miR-665	CLIP-seq
MIRT1160516	hsa-miR-888	CLIP-seq
MIRT1160479	hsa-miR-142-5p	CLIP-seq
MIRT1160483	hsa-miR-340	CLIP-seq
MIRT1160495	hsa-miR-410	CLIP-seq
MIRT2275185	hsa-miR-3117-5p	CLIP-seq
MIRT1160486	hsa-miR-369-3p	CLIP-seq
MIRT1160487	hsa-miR-374a	CLIP-seq
MIRT1160488	hsa-miR-374b	CLIP-seq
MIRT1160489	hsa-miR-374c	CLIP-seq
MIRT1160490	hsa-miR-382	CLIP-seq
MIRT2275186	hsa-miR-570	CLIP-seq
MIRT1160514	hsa-miR-655	CLIP-seq
MIRT2574195	hsa-miR-1205	CLIP-seq
MIRT2574196	hsa-miR-1224-3p	CLIP-seq
MIRT2574197	hsa-miR-217	CLIP-seq
MIRT2574198	hsa-miR-223	CLIP-seq
MIRT2574199	hsa-miR-2355-5p	CLIP-seq
MIRT2574200	hsa-miR-3065-3p	CLIP-seq
MIRT2275185	hsa-miR-3117-5p	CLIP-seq
MIRT2574201	hsa-miR-3665	CLIP-seq
MIRT2574202	hsa-miR-3919	CLIP-seq
MIRT2574203	hsa-miR-4276	CLIP-seq
MIRT2574204	hsa-miR-4286	CLIP-seq
MIRT2574205	hsa-miR-4418	CLIP-seq
MIRT2574206	hsa-miR-4468	CLIP-seq
MIRT2574207	hsa-miR-4697-3p	CLIP-seq
MIRT2574208	hsa-miR-4797-5p	CLIP-seq
MIRT2574209	hsa-miR-509-3-5p	CLIP-seq
MIRT2574210	hsa-miR-509-5p	CLIP-seq
MIRT2574211	hsa-miR-548c-3p	CLIP-seq
MIRT2275186	hsa-miR-570	CLIP-seq
MIRT2574212	hsa-miR-657	CLIP-seq
MIRT2574195	hsa-miR-1205	CLIP-seq
MIRT2574196	hsa-miR-1224-3p	CLIP-seq
MIRT2574197	hsa-miR-217	CLIP-seq
MIRT2574198	hsa-miR-223	CLIP-seq
MIRT2574199	hsa-miR-2355-5p	CLIP-seq
MIRT2574200	hsa-miR-3065-3p	CLIP-seq
MIRT2275185	hsa-miR-3117-5p	CLIP-seq
MIRT2574201	hsa-miR-3665	CLIP-seq
MIRT2574202	hsa-miR-3919	CLIP-seq
MIRT2574203	hsa-miR-4276	CLIP-seq
MIRT2574204	hsa-miR-4286	CLIP-seq
MIRT2574205	hsa-miR-4418	CLIP-seq
MIRT2574206	hsa-miR-4468	CLIP-seq
MIRT2574207	hsa-miR-4697-3p	CLIP-seq
MIRT1160509	hsa-miR-4772-3p	CLIP-seq
MIRT2574208	hsa-miR-4797-5p	CLIP-seq
MIRT2574209	hsa-miR-509-3-5p	CLIP-seq
MIRT2574210	hsa-miR-509-5p	CLIP-seq
MIRT2574211	hsa-miR-548c-3p	CLIP-seq
MIRT2275186	hsa-miR-570	CLIP-seq
MIRT2574212	hsa-miR-657	CLIP-seq

Show/Hide all (25)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003735	Function	Structural constituent of ribosome	IBA
GO:0003735	Function	Structural constituent of ribosome	IEA
GO:0003735	Function	Structural constituent of ribosome	ISS	11402041
GO:0003735	Function	Structural constituent of ribosome	NAS	11279123
GO:0005515	Function	Protein binding	IPI	22458338, 25416956, 32296183, 33961781
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA
GO:0005739	Component	Mitochondrion	IEA
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	NAS	27023846
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005763	Component	Mitochondrial small ribosomal subunit	IBA
GO:0005763	Component	Mitochondrial small ribosomal subunit	IDA	25838379
GO:0005763	Component	Mitochondrial small ribosomal subunit	IEA
GO:0005763	Component	Mitochondrial small ribosomal subunit	ISS	11402041
GO:0005763	Component	Mitochondrial small ribosomal subunit	NAS	25838379
GO:0005840	Component	Ribosome	IEA
GO:0006412	Process	Translation	IEA
GO:0006412	Process	Translation	NAS	11279123
GO:0015935	Component	Small ribosomal subunit	NAS	11279123
GO:0019843	Function	RRNA binding	IEA
GO:0032543	Process	Mitochondrial translation	ISS	11402041
GO:0032543	Process	Mitochondrial translation	NAS	27023846
GO:0070181	Function	Small ribosomal subunit rRNA binding	IBA
GO:1990904	Component	Ribonucleoprotein complex	IEA

MIM	HGNC	e!Ensembl
611973	14051	ENSG00000243927

P82932

Protein name

Small ribosomal subunit protein bS6m (28S ribosomal protein S6, mitochondrial) (MRP-S6) (S6mt)

PDB

3J9M , 6NU2 , 6NU3 , 6RW4 , 6RW5 , 6VLZ , 6VMI , 6ZM5 , 6ZM6 , 6ZS9 , 6ZSA , 6ZSB , 6ZSC , 6ZSD , 6ZSE , 6ZSG , 7A5F , 7A5G , 7A5I , 7A5K , 7L08 , 7OG4 , 7P2E , 7PNX , 7PNY , 7PNZ , 7PO0 , 7PO1 , 7PO2 , 7PO3 , 7QI4 , 7QI5 , 7QI6 , 8ANY , 8CSP , 8CSQ , 8CSR , 8CSS , 8CST , 8CSU , 8K2A , 8OIR , 8OIS , 8QRK , 8QRL , 8QRM , 8QRN , 8RRI , 8XT0 , 8XT2

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01250	Ribosomal_S6	3 → 95	Ribosomal protein S6	Domain

Sequence

MPRYELALILKAMQRPETAATLKRTIEALMDRGAIVRDLENLGERALPYRISAHSQQHNR
GGYFLVDFYAPTAAVESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYST
KKRKK

Sequence length

125

Interactions

View interactions

	KEGG		Reactome
	Ribosome		Mitochondrial translation elongation Mitochondrial translation termination

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (16)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	CTD, GWAS catalog CTD, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ATHEROSCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet, GWAS catalog Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TREATMENT-RESISTANT HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	35739158	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	CTD_human_DG	21378990		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	CTD_human_DG	21378990		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Diseases	Mitochondrial disease	Pubtator	17193926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	25697262		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	25697262	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	30972876	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	17193926	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

MRPS6 (mitochondrial ribosomal protein S6)