SIX1 (SIX homeobox 1)

Gene

• Entrez ID: 6495
• Gene name: SIX homeobox 1
• Gene symbol: SIX1
• Synonyms (NCBI Gene): BOS3, DFNA23, TIP39
• Chromosome: 14
• Chromosome location: 14q23.1
• Summary: The protein encoded by this gene is a homeobox protein that is similar to the Drosophila `sine oculis` gene product. This gene is found in a cluster of related genes on chromosome 14 and is thought to be involved in limb development. Defects in this gene

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005550	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Quantitative proteomic approach, Western blot	20603620
MIRT005550	hsa-miR-185-5p	Luciferase reporter assay, qRT-PCR, Quantitative proteomic approach, Western blot	20603620
MIRT016461	hsa-miR-193b-3p	Microarray	20304954
MIRT029669	hsa-miR-26b-5p	Microarray	19088304
MIRT042949	hsa-miR-324-3p	CLASH	23622248
MIRT054582	hsa-miR-30b-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24593661
MIRT054582	hsa-miR-30b-5p	Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24593661
MIRT438387	hsa-miR-204-5p	Luciferase reporter assay, Western blot	25157435
MIRT438387	hsa-miR-204-5p	Luciferase reporter assay, Western blot	25157435
MIRT612156	hsa-miR-345-3p	HITS-CLIP	19536157
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	19536157
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	19536157
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	19536157
MIRT612152	hsa-miR-4319	HITS-CLIP	19536157
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT612150	hsa-miR-670-5p	HITS-CLIP	19536157
MIRT612149	hsa-miR-7641	HITS-CLIP	19536157
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	19536157
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT638267	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT638266	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT666352	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT638265	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT638264	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT638263	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT638261	hsa-miR-2117	HITS-CLIP	23824327
MIRT638260	hsa-miR-623	HITS-CLIP	23824327
MIRT638259	hsa-miR-4279	HITS-CLIP	23824327
MIRT638257	hsa-miR-4273	HITS-CLIP	23824327
MIRT638256	hsa-miR-7156-5p	HITS-CLIP	23824327
MIRT638255	hsa-miR-4677-5p	HITS-CLIP	23824327
MIRT666351	hsa-miR-7159-3p	HITS-CLIP	23824327
MIRT666350	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT638254	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT405809	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT638267	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT638266	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT638265	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT638264	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT638263	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT638262	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT638261	hsa-miR-2117	HITS-CLIP	23824327
MIRT638260	hsa-miR-623	HITS-CLIP	23824327
MIRT638259	hsa-miR-4279	HITS-CLIP	23824327
MIRT638258	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT638257	hsa-miR-4273	HITS-CLIP	23824327
MIRT638256	hsa-miR-7156-5p	HITS-CLIP	23824327
MIRT638255	hsa-miR-4677-5p	HITS-CLIP	23824327
MIRT638254	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT405809	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT565667	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT565666	hsa-miR-4668-3p	PAR-CLIP	20371350
MIRT565665	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT565664	hsa-miR-3606-3p	PAR-CLIP	20371350
MIRT565663	hsa-miR-513a-3p	PAR-CLIP	20371350
MIRT565662	hsa-miR-513c-3p	PAR-CLIP	20371350
MIRT442601	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT565661	hsa-miR-4301	PAR-CLIP	20371350
MIRT565660	hsa-miR-3156-3p	PAR-CLIP	20371350
MIRT565659	hsa-miR-33a-5p	PAR-CLIP	20371350
MIRT565658	hsa-miR-33b-5p	PAR-CLIP	20371350
MIRT565657	hsa-miR-514a-3p	PAR-CLIP	20371350
MIRT565656	hsa-miR-514b-3p	PAR-CLIP	20371350
MIRT442602	hsa-miR-580-5p	PAR-CLIP	22100165
MIRT442601	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT442600	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT442599	hsa-miR-6817-3p	PAR-CLIP	22100165
MIRT442598	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT442597	hsa-miR-301a-5p	PAR-CLIP	22100165
MIRT442596	hsa-miR-301b-5p	PAR-CLIP	22100165
MIRT442594	hsa-miR-3921	PAR-CLIP	22100165
MIRT442595	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT442593	hsa-miR-4766-5p	PAR-CLIP	22100165
MIRT442592	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT442591	hsa-miR-6873-3p	PAR-CLIP	22100165
MIRT442590	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT442602	hsa-miR-580-5p	PAR-CLIP	22100165
MIRT442601	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT442600	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT442599	hsa-miR-6817-3p	PAR-CLIP	22100165
MIRT442598	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT442597	hsa-miR-301a-5p	PAR-CLIP	22100165
MIRT442596	hsa-miR-301b-5p	PAR-CLIP	22100165
MIRT442594	hsa-miR-3921	PAR-CLIP	22100165
MIRT442595	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT442593	hsa-miR-4766-5p	PAR-CLIP	22100165
MIRT442592	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT442591	hsa-miR-6873-3p	PAR-CLIP	22100165
MIRT442590	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	27418678
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	27418678
MIRT612156	hsa-miR-345-3p	HITS-CLIP	27418678
MIRT612152	hsa-miR-4319	HITS-CLIP	27418678
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	27418678
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	27418678
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	27418678
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	27418678
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	27418678
MIRT612150	hsa-miR-670-5p	HITS-CLIP	27418678
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	27418678
MIRT612149	hsa-miR-7641	HITS-CLIP	27418678
MIRT733107	hsa-miR-7160-3p	ELISA, qRT-PCR, Western blotting	33686961
MIRT612156	hsa-miR-345-3p	HITS-CLIP	19536157
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	19536157
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	19536157
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	19536157
MIRT612152	hsa-miR-4319	HITS-CLIP	19536157
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	19536157
MIRT612150	hsa-miR-670-5p	HITS-CLIP	19536157
MIRT612149	hsa-miR-7641	HITS-CLIP	19536157
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	19536157
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	19536157
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	19536157
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT638267	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT638266	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT666352	hsa-miR-501-5p	HITS-CLIP	23824327
MIRT638265	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT638264	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT638263	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT638261	hsa-miR-2117	HITS-CLIP	23824327
MIRT638260	hsa-miR-623	HITS-CLIP	23824327
MIRT638259	hsa-miR-4279	HITS-CLIP	23824327
MIRT638257	hsa-miR-4273	HITS-CLIP	23824327
MIRT638256	hsa-miR-7156-5p	HITS-CLIP	23824327
MIRT638255	hsa-miR-4677-5p	HITS-CLIP	23824327
MIRT666351	hsa-miR-7159-3p	HITS-CLIP	23824327
MIRT666350	hsa-miR-4482-3p	HITS-CLIP	23824327
MIRT638254	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT405809	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT638267	hsa-miR-362-5p	HITS-CLIP	23824327
MIRT638266	hsa-miR-500b-5p	HITS-CLIP	23824327
MIRT638265	hsa-miR-6832-3p	HITS-CLIP	23824327
MIRT638264	hsa-miR-6734-3p	HITS-CLIP	23824327
MIRT638263	hsa-miR-3667-3p	HITS-CLIP	23824327
MIRT638262	hsa-miR-6740-3p	HITS-CLIP	23824327
MIRT638261	hsa-miR-2117	HITS-CLIP	23824327
MIRT638260	hsa-miR-623	HITS-CLIP	23824327
MIRT638259	hsa-miR-4279	HITS-CLIP	23824327
MIRT638258	hsa-miR-511-5p	HITS-CLIP	23824327
MIRT638257	hsa-miR-4273	HITS-CLIP	23824327
MIRT638256	hsa-miR-7156-5p	HITS-CLIP	23824327
MIRT638255	hsa-miR-4677-5p	HITS-CLIP	23824327
MIRT638254	hsa-miR-6739-3p	HITS-CLIP	23824327
MIRT405809	hsa-miR-129-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT622261	hsa-miR-6728-3p	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT616072	hsa-miR-629-5p	HITS-CLIP	23824327
MIRT616071	hsa-miR-6740-5p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT616070	hsa-miR-3940-5p	HITS-CLIP	23824327
MIRT616069	hsa-miR-4507	HITS-CLIP	23824327
MIRT616068	hsa-miR-6839-3p	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT612156	hsa-miR-345-3p	HITS-CLIP	23824327
MIRT612155	hsa-miR-4732-3p	HITS-CLIP	23824327
MIRT612154	hsa-miR-125a-5p	HITS-CLIP	23824327
MIRT612153	hsa-miR-125b-5p	HITS-CLIP	23824327
MIRT612152	hsa-miR-4319	HITS-CLIP	23824327
MIRT612151	hsa-miR-4695-3p	HITS-CLIP	23824327
MIRT612150	hsa-miR-670-5p	HITS-CLIP	23824327
MIRT612149	hsa-miR-7641	HITS-CLIP	23824327
MIRT612148	hsa-miR-4755-5p	HITS-CLIP	23824327
MIRT612147	hsa-miR-5006-3p	HITS-CLIP	23824327
MIRT612146	hsa-miR-4446-5p	HITS-CLIP	23824327
MIRT565667	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT565666	hsa-miR-4668-3p	PAR-CLIP	20371350
MIRT565665	hsa-miR-605-5p	PAR-CLIP	20371350
MIRT565664	hsa-miR-3606-3p	PAR-CLIP	20371350
MIRT565663	hsa-miR-513a-3p	PAR-CLIP	20371350
MIRT565662	hsa-miR-513c-3p	PAR-CLIP	20371350
MIRT442601	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT565661	hsa-miR-4301	PAR-CLIP	20371350
MIRT565660	hsa-miR-3156-3p	PAR-CLIP	20371350
MIRT565659	hsa-miR-33a-5p	PAR-CLIP	20371350
MIRT565658	hsa-miR-33b-5p	PAR-CLIP	20371350
MIRT565657	hsa-miR-514a-3p	PAR-CLIP	20371350
MIRT565656	hsa-miR-514b-3p	PAR-CLIP	20371350
MIRT442602	hsa-miR-580-5p	PAR-CLIP	22100165
MIRT442601	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT442600	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT442599	hsa-miR-6817-3p	PAR-CLIP	22100165
MIRT442598	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT442597	hsa-miR-301a-5p	PAR-CLIP	22100165
MIRT442596	hsa-miR-301b-5p	PAR-CLIP	22100165
MIRT442594	hsa-miR-3921	PAR-CLIP	22100165
MIRT442595	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT442593	hsa-miR-4766-5p	PAR-CLIP	22100165
MIRT442592	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT442591	hsa-miR-6873-3p	PAR-CLIP	22100165
MIRT442590	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT442602	hsa-miR-580-5p	PAR-CLIP	22100165
MIRT442601	hsa-miR-3613-3p	PAR-CLIP	22100165
MIRT442600	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT442599	hsa-miR-6817-3p	PAR-CLIP	22100165
MIRT442598	hsa-miR-146a-3p	PAR-CLIP	22100165
MIRT442597	hsa-miR-301a-5p	PAR-CLIP	22100165
MIRT442596	hsa-miR-301b-5p	PAR-CLIP	22100165
MIRT442594	hsa-miR-3921	PAR-CLIP	22100165
MIRT442595	hsa-miR-4653-5p	PAR-CLIP	22100165
MIRT442593	hsa-miR-4766-5p	PAR-CLIP	22100165
MIRT442592	hsa-miR-203a-3p	PAR-CLIP	22100165
MIRT442591	hsa-miR-6873-3p	PAR-CLIP	22100165
MIRT442590	hsa-miR-192-3p	PAR-CLIP	22100165
MIRT1350367	hsa-miR-10a	CLIP-seq
MIRT1350368	hsa-miR-10b	CLIP-seq
MIRT1350369	hsa-miR-1304	CLIP-seq
MIRT1350370	hsa-miR-27a	CLIP-seq
MIRT1350371	hsa-miR-27b	CLIP-seq
MIRT1350372	hsa-miR-3616-3p	CLIP-seq
MIRT1350373	hsa-miR-4253	CLIP-seq
MIRT1350374	hsa-miR-4691-3p	CLIP-seq
MIRT1350375	hsa-miR-4721	CLIP-seq
MIRT1350376	hsa-miR-4761-3p	CLIP-seq
MIRT1350377	hsa-miR-513a-5p	CLIP-seq
MIRT1350378	hsa-miR-548v	CLIP-seq
MIRT1553693	hsa-miR-1263	CLIP-seq
MIRT1553694	hsa-miR-23a	CLIP-seq
MIRT1553695	hsa-miR-23b	CLIP-seq
MIRT1553696	hsa-miR-23c	CLIP-seq
MIRT1553697	hsa-miR-5096	CLIP-seq
MIRT1922375	hsa-miR-125b	CLIP-seq
MIRT1922376	hsa-miR-629	CLIP-seq
MIRT1922377	hsa-miR-670	CLIP-seq
MIRT2103802	hsa-miR-1253	CLIP-seq
MIRT2103803	hsa-miR-1254	CLIP-seq
MIRT2103804	hsa-miR-1270	CLIP-seq
MIRT2103805	hsa-miR-138	CLIP-seq
MIRT2103806	hsa-miR-185	CLIP-seq
MIRT2103807	hsa-miR-30a	CLIP-seq
MIRT2103808	hsa-miR-30b	CLIP-seq
MIRT2103809	hsa-miR-30c	CLIP-seq
MIRT2103810	hsa-miR-30d	CLIP-seq
MIRT2103811	hsa-miR-30e	CLIP-seq
MIRT2103812	hsa-miR-3116	CLIP-seq
MIRT2103813	hsa-miR-3150b-3p	CLIP-seq
MIRT2103814	hsa-miR-3160-5p	CLIP-seq
MIRT2103815	hsa-miR-3182	CLIP-seq
MIRT2103816	hsa-miR-3663-5p	CLIP-seq
MIRT2103817	hsa-miR-370	CLIP-seq
MIRT2103818	hsa-miR-380	CLIP-seq
MIRT2103819	hsa-miR-4254	CLIP-seq
MIRT2103820	hsa-miR-4277	CLIP-seq
MIRT2103821	hsa-miR-4303	CLIP-seq
MIRT2103822	hsa-miR-4306	CLIP-seq
MIRT2103823	hsa-miR-4421	CLIP-seq
MIRT2103824	hsa-miR-4527	CLIP-seq
MIRT2103825	hsa-miR-4531	CLIP-seq
MIRT2103826	hsa-miR-4644	CLIP-seq
MIRT2103827	hsa-miR-4659a-3p	CLIP-seq
MIRT2103828	hsa-miR-4659b-3p	CLIP-seq
MIRT2103829	hsa-miR-4784	CLIP-seq
MIRT2103830	hsa-miR-571	CLIP-seq
MIRT2103831	hsa-miR-620	CLIP-seq
MIRT1553694	hsa-miR-23a	CLIP-seq
MIRT1553695	hsa-miR-23b	CLIP-seq
MIRT1553696	hsa-miR-23c	CLIP-seq
MIRT2327974	hsa-miR-4775	CLIP-seq
MIRT2327975	hsa-miR-590-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	ISA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	16670092
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	15141091
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IMP	15141091
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001223	Function	Transcription coactivator binding	IEA
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	15141091
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	15141091
GO:0001657	Process	Ureteric bud development	IEA
GO:0001657	Process	Ureteric bud development	ISS
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	IEA
GO:0001658	Process	Branching involved in ureteric bud morphogenesis	ISS
GO:0001759	Process	Organ induction	IEA
GO:0001759	Process	Organ induction	ISS
GO:0001822	Process	Kidney development	IEA
GO:0001822	Process	Kidney development	ISS
GO:0003151	Process	Outflow tract morphogenesis	IEA
GO:0003677	Function	DNA binding	IDA	19497856
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	19497856
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0005515	Function	Protein binding	IPI	15141091, 16189514, 19497856, 20211142, 21516116, 23435380, 25416956, 25910212, 26235987, 27923061, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	16670092, 19497856
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005667	Component	Transcription regulator complex	ISS
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006915	Process	Apoptotic process	IEA
GO:0007219	Process	Notch signaling pathway	IEA
GO:0007389	Process	Pattern specification process	IEA
GO:0007389	Process	Pattern specification process	ISS
GO:0007519	Process	Skeletal muscle tissue development	IEA
GO:0007519	Process	Skeletal muscle tissue development	ISS
GO:0007605	Process	Sensory perception of sound	IEA
GO:0008582	Process	Regulation of synaptic assembly at neuromuscular junction	IEA
GO:0010467	Process	Gene expression	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0014033	Process	Neural crest cell differentiation	IEA
GO:0014842	Process	Regulation of skeletal muscle satellite cell proliferation	IEA
GO:0014857	Process	Regulation of skeletal muscle cell proliferation	IBA
GO:0021610	Process	Facial nerve morphogenesis	IEA
GO:0022008	Process	Neurogenesis	IEA
GO:0030855	Process	Epithelial cell differentiation	IEA
GO:0030855	Process	Epithelial cell differentiation	ISS
GO:0030878	Process	Thyroid gland development	IEA
GO:0030878	Process	Thyroid gland development	ISS
GO:0030910	Process	Olfactory placode formation	IEA
GO:0032880	Process	Regulation of protein localization	IEA
GO:0034504	Process	Protein localization to nucleus	IDA	19497856
GO:0035909	Process	Aorta morphogenesis	IEA
GO:0042472	Process	Inner ear morphogenesis	IEA
GO:0042472	Process	Inner ear morphogenesis	ISS
GO:0042474	Process	Middle ear morphogenesis	IEA
GO:0043066	Process	Negative regulation of apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	15141091
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0043586	Process	Tongue development	IEA
GO:0045664	Process	Regulation of neuron differentiation	IEA
GO:0045664	Process	Regulation of neuron differentiation	ISS
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	27923061
GO:0045893	Process	Positive regulation of DNA-templated transcription	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	15141091
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	15141091
GO:0048538	Process	Thymus development	IEA
GO:0048538	Process	Thymus development	ISS
GO:0048665	Process	Neuron fate specification	IEA
GO:0048699	Process	Generation of neurons	IEA
GO:0048699	Process	Generation of neurons	ISS
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	IEA
GO:0048701	Process	Embryonic cranial skeleton morphogenesis	ISS
GO:0048704	Process	Embryonic skeletal system morphogenesis	IEA
GO:0048704	Process	Embryonic skeletal system morphogenesis	ISS
GO:0048705	Process	Skeletal system morphogenesis	IEA
GO:0048741	Process	Skeletal muscle fiber development	IBA
GO:0048839	Process	Inner ear development	IEA
GO:0048839	Process	Inner ear development	ISS
GO:0050678	Process	Regulation of epithelial cell proliferation	IEA
GO:0051450	Process	Myoblast proliferation	IEA
GO:0051451	Process	Myoblast migration	IEA
GO:0051451	Process	Myoblast migration	ISS
GO:0060037	Process	Pharyngeal system development	IEA
GO:0061055	Process	Myotome development	IEA
GO:0061197	Process	Fungiform papilla morphogenesis	IEA
GO:0061551	Process	Trigeminal ganglion development	IEA
GO:0071599	Process	Otic vesicle development	IEA
GO:0072075	Process	Metanephric mesenchyme development	IEA
GO:0072075	Process	Metanephric mesenchyme development	ISS
GO:0072095	Process	Regulation of branch elongation involved in ureteric bud branching	IEA
GO:0072095	Process	Regulation of branch elongation involved in ureteric bud branching	ISS
GO:0072107	Process	Positive regulation of ureteric bud formation	IEA
GO:0072107	Process	Positive regulation of ureteric bud formation	ISS
GO:0072172	Process	Mesonephric tubule formation	IEA
GO:0072172	Process	Mesonephric tubule formation	ISS
GO:0072193	Process	Ureter smooth muscle cell differentiation	IEA
GO:0072198	Process	Mesenchymal cell proliferation involved in ureter development	IEA
GO:0072513	Process	Positive regulation of secondary heart field cardioblast proliferation	IEA
GO:0086100	Process	Endothelin receptor signaling pathway	IEA
GO:0090103	Process	Cochlea morphogenesis	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	IEA
GO:0090190	Process	Positive regulation of branching involved in ureteric bud morphogenesis	ISS
GO:0090336	Process	Positive regulation of brown fat cell differentiation	IEA
GO:0090336	Process	Positive regulation of brown fat cell differentiation	ISS
GO:1905243	Process	Cellular response to 3,3',5-triiodo-L-thyronine	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000288	Process	Positive regulation of myoblast proliferation	IEA
GO:2000729	Process	Positive regulation of mesenchymal cell proliferation involved in ureter development	IEA
GO:2001014	Process	Regulation of skeletal muscle cell differentiation	IEA

Other IDs

• MIM: 601205
• HGNC: 10887
• e!Ensembl: ENSG00000126778

Protein

• UniProt ID: Q15475
• Protein name: Homeobox protein SIX1 (Sine oculis homeobox homolog 1)
• Protein function: Transcription factor that is involved in the regulation of cell proliferation, apoptosis and embryonic development (By similarity). Plays an important role in the development of several organs, including kidney, muscle and inner ear (By similari
• PDB: 4EGC
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16878	SIX1_SD	9 → 119	Transcriptional regulator, SIX1, N-terminal SD domain	Domain
  PF00046	Homeodomain	127 → 181	Homeodomain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Specifically expressed in skeletal muscle.
• Sequence:

  MSMLPSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHR
  GNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRT
  IWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDR
  AAEAKERENTENNNSSSNKQNQLSPLEGGKPLMSSSEEEFSPPQSPDQNSVLLLQGNMGH
  ARSSNYSLPGLTASQPSHGLQTHQHQLQDSLLGPLTSSLVDLGS

• Sequence length: 284

Pathways

KEGG:

Transcriptional misregulation in cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Autosomal dominant nonsyndromic hearing loss	Likely pathogenic	rs2140241235	RCV001794854	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autosomal dominant nonsyndromic hearing loss 23	Pathogenic; Likely pathogenic	rs1303947821, rs1064794308, rs797044960, rs104894478, rs80356459, rs80356460, rs2502644085, rs1895003578, rs1060499595	RCV004794547 RCV002027546 RCV000190433 RCV000679883 RCV002512919 RCV000008808 RCV003810275 RCV004585131 RCV000477918	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Branchiootic syndrome	Pathogenic	rs104894478	RCV004719033	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Branchiootic syndrome 3	Likely pathogenic; Pathogenic	rs2140241235, rs1064794308, rs863223330, rs797044960, rs104894478, rs80356459, rs80356460, rs121909770, rs2502644174, rs2502643915, rs2502644085, rs761906849, rs2502639357, rs1060499595, rs1895001312	RCV001568419 RCV002027546 RCV000201277 RCV001852527 RCV000008806 RCV000008807 RCV000020636 RCV000008809 RCV003229777 RCV003229778 RCV003810275 RCV003991289 RCV003991933 RCV000477918 RCV003223408 RCV001250998	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Branchiootorenal syndrome 1	Pathogenic	rs104894478	RCV000763344	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Melnick-Fraser syndrome	Likely pathogenic	rs2502643576	RCV002471424	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
SIX1-related disorder	Pathogenic	rs104894478	RCV003390661	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTOSOMAL DOMINANT ISOLATED SENSORINEURAL DEAFNESS TYPE DFNA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BOR SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRANCHIO-OTO-RENAL SYNDROME	—	CTD, ClinGen, Disgenet, GenCC CTD, ClinGen, Disgenet, GenCC CTD, ClinGen, Disgenet, GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Branchiootic syndrome 1	Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Branchiootorenal Spectrum Disorders	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ABNORMALITIES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL ABNORMALITY	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CRANIOFACIAL ABNORMALITIES	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 23	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hearing impairment	Uncertain significance; Conflicting classifications of pathogenicity	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nonsyndromic Hearing Loss, Dominant	Uncertain significance; Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SENSORINEURAL HEARING LOSS OF BILATERAL EARS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unilateral deafness	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
WILMS TUMOR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	31806659		★☆☆☆☆ Found in Text Mining only
Acute Undifferentiated Leukemia	Leukemia	BEFREE	31050834		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	22190591, 25951369		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	22190591		★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	26473286		★☆☆☆☆ Found in Text Mining only
ANTERIOR SEGMENT ANOMALIES WITH OR WITHOUT CATARACT	Anterior segment anomalies	ORPHANET_DG	15141091		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30362537		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	32065213	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	26497896	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	28901379		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	34894925	Associate	★☆☆☆☆ Found in Text Mining only
Autosomal dominant non-syndromic sensorineural deafness type DFNA	Non-Syndromic Sensorineural Deafness	Orphanet			★☆☆☆☆ Found in Text Mining only
Behavioral tic	Tourette syndrome	BEFREE	22765220		★☆☆☆☆ Found in Text Mining only
Bilateral renal hypoplasia	Bilateral renal hypoplasia	BEFREE	24899122		★☆☆☆☆ Found in Text Mining only
Bilateral Wilms Tumor	Wilms tumor	CTD_human_DG	28825729		★☆☆☆☆ Found in Text Mining only
BOR syndrome	BOR Syndrome	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Branchial Clefts-Congenital disorder	Branchial Clefts-Congenital Disorder	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Branchio-Oculo-Facial Syndrome	Branchiooculofacial Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Branchio-Oto-Renal Syndrome	Branchiootorenal Syndrome	CLINGEN_DG	12874121, 15141091, 17637804, 18330911, 19389353, 19497856, 21254961, 21700001, 24164807, 29500469		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Branchio-Oto-Renal Syndrome	Branchiootorenal Syndrome	BEFREE	15141091, 16491411, 16971658, 17238186, 17357085, 18330911, 18666230, 19497856, 20110314, 22447252, 22659139, 23435380, 23840632		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Branchio-Oto-Renal Syndrome	Branchiootorenal Syndrome	LHGDN	15141091, 17637804, 18330911		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Branchio-Oto-Renal Syndrome	Branchiootorenal Syndrome	GENOMICS_ENGLAND_DG	9770533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Branchio-Oto-Renal Syndrome	Branchiootorenal Syndrome	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Branchioma	Branchioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Branchiootic syndrome	Branchiootic Syndrome	ORPHANET_DG	15141091		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Branchiootic syndrome	Branchiootic Syndrome	Orphanet			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Branchiootic syndrome	Branchiootic Syndrome	BEFREE	24899122, 31595699		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
BRANCHIOOTIC SYNDROME 1	Branchiootic syndrome	ORPHANET_DG	15141091		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Branchiootic Syndrome 3	Branchiootic syndrome	Pubtator	18666230	Associate	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
BRANCHIOOTIC SYNDROME 3 (disorder)	Branchiootic syndrome	GENOMICS_ENGLAND_DG	10777717, 9770533		★☆☆☆☆ Found in Text Mining only
BRANCHIOOTIC SYNDROME 3 (disorder)	Branchiootic syndrome	UNIPROT_DG	15141091, 17637804, 18330911, 19497856, 21280147, 23435380		★☆☆☆☆ Found in Text Mining only
BRANCHIOOTIC SYNDROME 3 (disorder)	Branchiootic syndrome	BEFREE	18666230, 30905259		★☆☆☆☆ Found in Text Mining only
BRANCHIOOTIC SYNDROME 3 (disorder)	Branchiootic syndrome	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
BRANCHIOOTIC SYNDROME 3 (disorder)	Branchiootic syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Branchiootorenal Syndrome 1	Melnick-Fraser syndrome	CLINVAR_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Branchiootorenal Syndrome 1	Melnick-Fraser syndrome	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Branchiootorenal Syndrome 2	Branchiootorenal Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15123840, 15805264, 18381426, 19726879, 19726883, 19726885, 20603620, 21056993, 21706047, 22286770, 22466647, 22765220, 24184484, 25062904, 25555392, 26408179, 27399099, 29455928, 31128917, 31404537		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21706047, 22286770, 26408179, 26773176, 29455928, 33299122, 34711117	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38031089	Stimulate	★☆☆☆☆ Found in Text Mining only
Bronchiolitis Obliterans	Bronchiolitis Obliterans	BEFREE	15141091, 29257230		★☆☆☆☆ Found in Text Mining only
Bulbo-Spinal Atrophy, X-Linked	Bulbospinal Atrophy, X-Linked	BEFREE	30548112		★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of kidney and urinary tract	BEFREE	24899122		★☆☆☆☆ Found in Text Mining only
Cakut	Congenital anomalies of the kidney and urinary tract	Pubtator	37499630	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21370601	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29455928, 32022559, 38031089	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	17409410		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17008870, 24706304, 25031720, 29656300, 36261513	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	31044528	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30177858, 31128917		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	29478945		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	17409410, 22333994, 27780136		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	26499333		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	21370601, 21874375, 24970368, 27878258, 31210295, 31425971		★☆☆☆☆ Found in Text Mining only
Cervical Intraepithelial Neoplasia	Cervical Intraepithelial Neoplasia	BEFREE	21874375, 24970368		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	21370601, 21874375, 24970368, 27878258, 31210295, 31425971		★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cochlear Diseases	Cochlear diseases	Pubtator	31595699	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22286765, 24551283, 25951369, 28199476, 30548112, 31016902, 31404537		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30548112, 31016902, 36071678, 36961205	Associate	★☆☆☆☆ Found in Text Mining only
Conductive hearing loss	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital absence of kidney	Renal agenesis	BEFREE	20110314		★☆☆☆☆ Found in Text Mining only
Congenital absence of kidneys syndrome	Renal agenesis	BEFREE	20110314		★☆☆☆☆ Found in Text Mining only
Congenital absence of kidneys syndrome	Renal agenesis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Dysplasia Of The Hip	Developmental dysplasia of the hip	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital malrotation of intestine	Congenital malrotation of intestine	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital small ears	Microtia	GENOMICS_ENGLAND_DG	9770533		★☆☆☆☆ Found in Text Mining only
Congenital small ears	Microtia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	30771307		★☆☆☆☆ Found in Text Mining only
Conotruncal defect	Conotruncal defect	BEFREE	29043394		★☆☆☆☆ Found in Text Mining only
Deafness	Deafness	Pubtator	15958501, 37479820	Associate	★☆☆☆☆ Found in Text Mining only
Deafness Autosomal Dominant 23	Deafness	Pubtator	37479820	Associate	★☆☆☆☆ Found in Text Mining only
DEAFNESS, AUTOSOMAL DOMINANT 23	Deafness	GENOMICS_ENGLAND_DG	10777717, 9770533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 23	Deafness	CLINVAR_DG	15141091, 19497856		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEAFNESS, AUTOSOMAL DOMINANT 23	Deafness	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes	Diabetes	BEFREE	28315934		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28315934		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	34894925	Associate	★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	21968101		★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane retraction syndrome	Pubtator	25463612, 31425971	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	27259717, 31579409		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	27259717		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	27259717		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37723477	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Epilepsy	Epilepsy	Pubtator	34588521	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	27987372		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	27987372		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27987372	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	27987372	Associate	★☆☆☆☆ Found in Text Mining only
Esotropia	Esotropia	Pubtator	34044792	Associate	★☆☆☆☆ Found in Text Mining only
Euthyroid Goiter	Euthyroid Goiter	HPO_DG			★☆☆☆☆ Found in Text Mining only
Facial paralysis	Facial paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fistula of branchial cleft	Fistula Of Branchial Cleft	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontonasal dysplasia	Frontonasal Dysplasia	BEFREE	30905259		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	21427129, 25489222, 28663559		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	28663559, 32719476	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma Open Angle	Open angle glaucoma	Pubtator	21398277, 23963167, 25242315, 25414181, 25798827, 36596020	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	21872936, 22840486, 25242315		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	21398277, 22570617, 22584021, 24150847, 25711633, 27260188, 29190129, 29405792, 31284308		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23727239, 28454249, 30231237		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	23727239	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Goldenhar Syndrome	Goldenhar Syndrome	BEFREE	18666230		★☆☆☆☆ Found in Text Mining only
Goldenhar Syndrome	Goldenhar syndrome	Pubtator	18666230	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	10777717	Stimulate	★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	24164807, 31595699	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss Sensorineural	Hearing loss	Pubtator	31595699	Associate	★☆☆☆☆ Found in Text Mining only
Hearing Loss, Mixed Conductive-Sensorineural	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	30771307		★☆☆☆☆ Found in Text Mining only
Hemorrhage	Hemorrhage	Pubtator	34588521	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	26473286		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	26473286	Associate	★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	20110314, 24899122		★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	40262004	Inhibit	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	15141091	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30528456		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	31050834		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17008870, 20013809, 24706304, 29333942, 29435409, 29656300, 31044528, 31099050, 31404537		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	17008870		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	29656300		★☆☆☆☆ Found in Text Mining only
Low Tension Glaucoma	Low Tension Glaucoma	BEFREE	22584021, 25461262, 25711633		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	30177858	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21370601, 21874375, 38031089	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	22466647		★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	14704789		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	28454249		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15123840, 15805264, 19726879, 19726883, 19726885, 20603620, 21056993, 21706047, 22286770, 22466647, 22765220, 24184484, 25062904, 25555392, 26408179, 27399099, 29455928, 31128917, 31404537		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	27259717, 31579409		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	27987372		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30177858, 31128917		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	17409410, 22333994, 27780136		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	23527134, 28388884		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28573504		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28367243, 30379332		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19726883, 19726885, 20013809, 20603620, 21706047, 24574515, 24866365, 25062904, 25555392, 26473286, 27259717, 28199476, 28388884, 28521394, 29455928, 29807230, 30691681, 31044528, 31128917, 31425971, 31597742		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	21370601, 21874375, 24970368, 27878258, 31210295, 31425971		★☆☆☆☆ Found in Text Mining only
Malrotation of kidney	Malrotation Of Kidney	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	15123840		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18381426		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31069961, 31128917		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	29660031		★☆☆☆☆ Found in Text Mining only
Microdontia (disorder)	Microdontia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	30548112		★☆☆☆☆ Found in Text Mining only
Multicystic Dysplastic Kidney	Multicystic renal dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	30962263		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15123840, 15805264, 17409410, 19726879, 19726883, 20603620, 21056993, 21370601, 21874375, 22286765, 22286770, 22765220, 23527134, 24551283, 24866365, 24970368, 25555392, 25670082, 25951369, 26500063, 27987372, 28199476, 28454249, 28521394, 29333942, 29455928, 30177858, 30691681, 30723235, 31404537		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	20603620		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	CTD_human_DG	28825729		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	19101580		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25157435, 31534348, 31686523		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	25062904		★☆☆☆☆ Found in Text Mining only
Nonsyndromic Deafness	Nonsyndromic Deafness	BEFREE	10777717		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	24114014, 28521394, 29807230, 30387818		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24114014	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	17409410		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22333994, 27780136		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	23527134, 28388884		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	36937004	Associate	★☆☆☆☆ Found in Text Mining only
Papillorenal syndrome	Renal Coloboma Syndrome	BEFREE	16971658		★☆☆☆☆ Found in Text Mining only
Platelet Glycoprotein IV Deficiency	Platelet Glycoprotein IV Deficiency	BEFREE	26528880		★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	25217961		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate carcinoma	Prostate cancer	BEFREE	28573504		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28573504, 35414775	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30362537		★☆☆☆☆ Found in Text Mining only
RENAL ADYSPLASIA	Renal Aplasia	BEFREE	20110314		★☆☆☆☆ Found in Text Mining only
Renal Cell Dysplasia	Renal dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal dysplasia	Renal dysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Renal steatosis	Renal steatosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	14704789, 15805264, 16488997, 20603620		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	37224459	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	37468459	Inhibit	★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	BEFREE	31595699		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sensorineural hearing loss, bilateral	Sensorineural hearing loss	BEFREE	31595699		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency Autosomal Recessive T Cell Negative B Cell Positive NK Cell Positive	Severe combined immunodeficiency	Pubtator	36937004	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	27987372, 28260921		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	26490981	Associate	★☆☆☆☆ Found in Text Mining only
Stenosis of external auditory canal	Stenosis Of External Auditory Canal	HPO_DG			★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28367243, 30379332		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	24716913, 39223727	Associate	★☆☆☆☆ Found in Text Mining only
Tic disorder	Tic Disorder	BEFREE	22765220		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	21370601	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18398830	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21370601, 21874375, 31210295, 31425971, 32022559	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	34894925	Associate	★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	HPO_DG			★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	25670082, 25670083, 26802027, 28825729, 30671724, 37815464	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations