NT5DC2 (5'-nucleotidase domain containing 2)

Gene

• Entrez ID: 64943
• Gene name: 5'-nucleotidase domain containing 2
• Gene symbol: NT5DC2
• Synonyms (NCBI Gene): -
• Chromosome: 3
• Chromosome location: 3p21.1

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030270	hsa-miR-26b-5p	Microarray	19088304
MIRT052241	hsa-let-7b-5p	CLASH	23622248
MIRT051686	hsa-let-7e-5p	CLASH	23622248
MIRT051291	hsa-miR-16-5p	CLASH	23622248
MIRT046905	hsa-miR-221-3p	CLASH	23622248
MIRT042644	hsa-miR-423-3p	CLASH	23622248
MIRT042173	hsa-miR-484	CLASH	23622248
MIRT037848	hsa-miR-455-3p	CLASH	23622248
MIRT036776	hsa-miR-760	CLASH	23622248
MIRT2056814	hsa-miR-3675-5p	CLIP-seq
MIRT2056815	hsa-miR-486-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0008253	Function	5'-nucleotidase activity	IBA
GO:0016787	Function	Hydrolase activity	IEA
GO:0033137	Process	Negative regulation of peptidyl-serine phosphorylation	ISS
GO:0045914	Process	Negative regulation of catecholamine metabolic process	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0051354	Process	Negative regulation of oxidoreductase activity	ISS
GO:1903180	Process	Negative regulation of dopamine biosynthetic process	ISS

Other IDs

• MIM: 621077
• HGNC: 25717
• e!Ensembl: ENSG00000168268

Protein

• UniProt ID: Q9H857
• Protein name: 5'-nucleotidase domain-containing protein 2 (EC 3.1.3.-)
• Protein function: Promotes dephosphorylation of tyrosine 3-monooxygenase TH which decreases TH catalytic activity and leads to reduced synthesis of catecholamines including dopamine, noradrenaline and adrenaline. The exact mechanism of activity is unknown but may
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05761	5_nucleotid	56 → 497		Family

• Sequence:

  MRVESGSAQERGILLESLSTLLEKTTASHEGRAPGNRELTDLLPPEVCSLLNPAAIYANN
  EISLRDVEVYGFDYDYTLAQYADALHPEIFSTARDILIEHYKYPEGIRKYDYNPSFAIRG
  LHYDIQKSLLMKIDAFHYVQLGTAYRGLQPVPDEEVIELYGGTQHIPLYQMSGFYGKGPS
  IKQFMDIFSLPEMALLSCVVDYFLGHSLEFDQAHLYKDVTDAIRDVHVKGLMYQWIEQDM
  EKYILRGDETFAVLSRLVAHGKQLFLITNSPFSFVDKGMRHMVGPDWRQLFDVVIVQADK
  PSFFTDRRKPFRKLDEKGSLQWDRITRLEKGKIYRQGNLFDFLRLTEWRGPRVLYFGDHL
  YSDLADLMLRHGWRTGAIIPELEREIRIINTEQYMHSLTWQQALTGLLERMQTYQDAESR
  QVLAAWMKERQELRCITKALFNAQFGSIFRTFHNPTYFSRRLVRFSDLYMASLSCLLNYR
  VDFTFYPRRTPLQHEAPLWMDQLCTGCMKTPFLGDMAHIR

• Sequence length: 520

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CATARACT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Borderline Personality Disorder	Borderline personality disorder	Pubtator	25612291	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	30978441		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36820551	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	39596612	Associate	★☆☆☆☆ Found in Text Mining only
Depressive Disorder Major	Major depressive disorder	Pubtator	25612291	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	30978441		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	30978441		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	30978441		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	39684755	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GWASCAT_DG	27903959		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	GWASCAT_DG	29559693		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	BEFREE	31279527		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	37800836	Associate	★☆☆☆☆ Found in Text Mining only