SIPA1 (signal-induced proliferation-associated 1)

Gene

• Entrez ID: 6494
• Gene name: Signal-induced proliferation-associated 1
• Gene symbol: SIPA1
• Synonyms (NCBI Gene): SPA1
• Chromosome: 11
• Chromosome location: 11q13.1
• Summary: The product of this gene is a mitogen induced GTPase activating protein (GAP). It exhibits a specific GAP activity for Ras-related regulatory proteins Rap1 and Rap2, but not for Ran or other small GTPases. This protein may also hamper mitogen-induced cell

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT030296	hsa-miR-26b-5p	Microarray	19088304
MIRT486321	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT486322	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT486320	hsa-miR-542-5p	PAR-CLIP	23592263
MIRT486319	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT486318	hsa-miR-6087	PAR-CLIP	23592263
MIRT486317	hsa-miR-661	PAR-CLIP	23592263
MIRT486316	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT486315	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT486314	hsa-miR-663a	PAR-CLIP	23592263
MIRT486313	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT486312	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT486311	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT486310	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT486308	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT486309	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT486307	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT486306	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT486305	hsa-miR-7704	PAR-CLIP	23592263
MIRT486304	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT486303	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT486302	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT486301	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT486299	hsa-miR-3689c	PAR-CLIP	23592263
MIRT486300	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT486298	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT486321	hsa-miR-6777-5p	PAR-CLIP	23592263
MIRT486322	hsa-miR-6889-5p	PAR-CLIP	23592263
MIRT486320	hsa-miR-542-5p	PAR-CLIP	23592263
MIRT486319	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT486318	hsa-miR-6087	PAR-CLIP	23592263
MIRT486317	hsa-miR-661	PAR-CLIP	23592263
MIRT486316	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT486315	hsa-miR-1908-5p	PAR-CLIP	23592263
MIRT486314	hsa-miR-663a	PAR-CLIP	23592263
MIRT486313	hsa-miR-6787-5p	PAR-CLIP	23592263
MIRT486312	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT486311	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT486310	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT486308	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT486309	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT486307	hsa-miR-6799-5p	PAR-CLIP	23592263
MIRT486306	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT486305	hsa-miR-7704	PAR-CLIP	23592263
MIRT486304	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT486303	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT486302	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT486301	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT486299	hsa-miR-3689c	PAR-CLIP	23592263
MIRT486300	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT486298	hsa-miR-6780a-5p	PAR-CLIP	23592263

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	TAS
GO:0005096	Function	GTPase activator activity	EXP	16076873
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	NAS	9346962
GO:0005515	Function	Protein binding	IPI	21988832
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0007010	Process	Cytoskeleton organization	NAS	12059963
GO:0007162	Process	Negative regulation of cell adhesion	NAS	10373454
GO:0007165	Process	Signal transduction	TAS	9346962
GO:0012505	Component	Endomembrane system	IEA
GO:0016020	Component	Membrane	IEA
GO:0030308	Process	Negative regulation of cell growth	NAS	9183624
GO:0032991	Component	Protein-containing complex	IEA
GO:0035556	Process	Intracellular signal transduction	NAS	9346962
GO:0042631	Process	Cellular response to water deprivation	IEA
GO:0045786	Process	Negative regulation of cell cycle	NAS	7799964
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA

Other IDs

• MIM: 602180
• HGNC: 10885
• e!Ensembl: ENSG00000213445

Protein

• UniProt ID: Q96FS4
• Protein name: Signal-induced proliferation-associated protein 1 (Sipa-1) (GTPase-activating protein Spa-1) (p130 SPA-1)
• Protein function: GTPase activator for the nuclear Ras-related regulatory proteins Rap1 and Rap2 in vitro, converting them to the putatively inactive GDP-bound state (PubMed:9346962). Affects cell cycle progression (By similarity). {ECO:0000250|UniProtKB:P46062,
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF02145	Rap_GAP	350 → 533	Rap/ran-GAP	Family
  PF00595	PDZ	687 → 759	PDZ domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in fetal as well as in adult tissues. Expressed abundantly in the lymphoid tissues such as thymus, spleen and peripheral blood lymphocytes and also shows a significant expression in the spinal cord.
• Sequence:

  MPMWAGGVGSPRRGMAPASTDDLFARKLRQPARPPLTPHTFEPRPVRGPLLRSGSDAGEA
  RPPTPASPRARAHSHEEASRPAATSTRLFTDPLALLGLPAEEPEPAFPPVLEPRWFAHYD
  VQSLLFDWAPRSQGMGSHSEASSGTLASAEDQAASSDLLHGAPGFVCELGGEGELGLGGP
  ASPPVPPALPNAAVSILEEPQNRTSAYSLEHADLGAGYYRKYFYGKEHQNFFGMDESLGP
  VAVSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVA
  PQLSPSCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGPAF
  MQFLTLLGDVVRLKGFESYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQ
  QLLRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHTPCTPHTTYRVAVSRT
  QDTPAFGPALPAGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLA
  TNEVTTTSLDSASRFGLPSLGGRRRAAPRGPGAELQAAGSLVWGVRAAPGARVAAGAQAS
  GPEGIEVPCLLGISAEALVLVAPRDGRVVFNCACRDVLAWTFSEQQLDLYHGRGEAITLR
  FDGSPGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGFEVDAEGFVTHVERFTFAETA
  GLRPGARLLRVCGQTLPSLRPEAAAQLLRSAPKVCVTVLPPDESGRPRRSFSELYTLSLQ
  EPSRRGAPDPVQDEVQGVTLLPTTKQLLHLCLQDGGSPPGPGDLAEERTEFLHSQNSLSP
  RSSLSDEAPVLPNTTPDLLLATTAKPSVPSADSETPLTQDRPGSPSGSEDKGNPAPELRA
  SFLPRTLSLRNSISRIMSEAGSGTLEDEWQAISEIASTCNTILESLSREGQPIPESGDPK
  GTPKSDAEPEPGNLSEKVSHLESMLRKLQEDLQKEKADRAALEEEVRSLRHNNRRLQAES
  ESAATRLLLASKQLGSPTADLA

• Sequence length: 1042

Pathways

KEGG:

Rap1 signaling pathway
Leukocyte transendothelial migration

Reactome:

Rap1 signalling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTOINFLAMMATORY DISEASE, FAMILIAL, BEHCET-LIKE-3	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal atresia	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
ESSENTIAL HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar CTD	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pyloric stenosis	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Anemia	Anemia	BEFREE	12892713		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	12892713		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16563182, 19089925, 19765277, 24006220, 24704834, 26901824		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16563182, 19089925, 19765277, 19825179, 23771732, 32193333, 33296812, 33753200	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary Dysplasia	BEFREE	17726703		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23661532		★☆☆☆☆ Found in Text Mining only
Chronic sinusitis	Sinusitis	BEFREE	17599561		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	22990111		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	30146127		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	30146127	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Craniosynostosis	Craniosynostosis	BEFREE	17599561		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	17599561		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	15310461		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	19765277	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	28556957		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34894858	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19765277, 19906411, 23771732	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16563182, 19089925, 19765277, 24006220, 24704834, 26901824		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23661532		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28237246		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28362978		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19906411, 23661532, 24704834, 28237246		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16563182, 19089925		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	23771732		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22535842		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
melanoma	Melanoma	CTD_human_DG	22535842		★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	9651531		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	12892713		★☆☆☆☆ Found in Text Mining only
Myelodysplastic-Myeloproliferative Diseases	Myelodysplastic-Myeloproliferative Diseases	BEFREE	29514790		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	12892713, 29500416		★☆☆☆☆ Found in Text Mining only
Nasal Polyps	Nasal polyposis	BEFREE	17599561		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12892713, 23771732, 24704834, 28362978, 9205112		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25352027		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	27597141		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	34134622	Associate	★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	19765277		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28237246		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28362978		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28362978	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	37500797	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19906411	Associate	★☆☆☆☆ Found in Text Mining only