Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	64866
Gene name	CUB domain containing protein 1
Gene symbol	CDCP1
Synonyms (NCBI Gene)	CD318SIMA135TRASK
Chromosome	3
Chromosome location	3p21.31
Summary	This gene encodes a transmembrane protein which contains three extracellular CUB domains and acts as a substrate for Src family kinases. The protein plays a role in the tyrosine phosphorylation-dependent regulation of cellular events that are involved in

435

Show/Hide all (435)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005178	hsa-miR-30a-5p	pSILAC	18668040
MIRT001377	hsa-miR-1-3p	pSILAC	18668040
MIRT017343	hsa-miR-335-5p	Microarray	18185580
MIRT022365	hsa-miR-124-3p	Microarray	18668037
MIRT001377	hsa-miR-1-3p	Proteomics	18668040
MIRT001377	hsa-miR-1-3p	Microarray	18668037
MIRT005178	hsa-miR-30a-5p	Proteomics;Other	18668040
MIRT574126	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT574125	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT574124	hsa-miR-939-3p	PAR-CLIP	20371350
MIRT574122	hsa-miR-6852-5p	PAR-CLIP	20371350
MIRT574123	hsa-miR-6742-3p	PAR-CLIP	20371350
MIRT574121	hsa-miR-4667-5p	PAR-CLIP	20371350
MIRT574120	hsa-miR-4700-5p	PAR-CLIP	20371350
MIRT574119	hsa-miR-8089	PAR-CLIP	20371350
MIRT574118	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT574117	hsa-miR-3144-5p	PAR-CLIP	20371350
MIRT574116	hsa-miR-3191-3p	PAR-CLIP	20371350
MIRT574115	hsa-miR-4652-5p	PAR-CLIP	20371350
MIRT574114	hsa-miR-1343-3p	PAR-CLIP	20371350
MIRT574113	hsa-miR-6783-3p	PAR-CLIP	20371350
MIRT574112	hsa-miR-6810-5p	PAR-CLIP	20371350
MIRT460051	hsa-miR-302f	PAR-CLIP	20371350
MIRT460050	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT460049	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT460048	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT564111	hsa-miR-4459	PAR-CLIP	20371350
MIRT460043	hsa-miR-665	PAR-CLIP	20371350
MIRT564110	hsa-miR-6840-3p	PAR-CLIP	20371350
MIRT460042	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT564109	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT564108	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT564107	hsa-miR-1827	PAR-CLIP	20371350
MIRT460035	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT460032	hsa-miR-3612	PAR-CLIP	20371350
MIRT460031	hsa-miR-650	PAR-CLIP	20371350
MIRT460030	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT460029	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT460028	hsa-miR-8085	PAR-CLIP	20371350
MIRT460027	hsa-miR-1233-5p	PAR-CLIP	20371350
MIRT460026	hsa-miR-6778-5p	PAR-CLIP	20371350
MIRT564106	hsa-miR-6807-5p	PAR-CLIP	20371350
MIRT564105	hsa-miR-1273e	PAR-CLIP	20371350
MIRT460024	hsa-miR-30c-1-3p	PAR-CLIP	20371350
MIRT460023	hsa-miR-30c-2-3p	PAR-CLIP	20371350
MIRT460022	hsa-miR-6788-5p	PAR-CLIP	20371350
MIRT460051	hsa-miR-302f	PAR-CLIP	23592263
MIRT460050	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT460049	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT460048	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT460047	hsa-miR-3929	PAR-CLIP	23592263
MIRT460046	hsa-miR-4419b	PAR-CLIP	23592263
MIRT460045	hsa-miR-4478	PAR-CLIP	23592263
MIRT460044	hsa-miR-4257	PAR-CLIP	23592263
MIRT460043	hsa-miR-665	PAR-CLIP	23592263
MIRT460041	hsa-miR-7162-3p	PAR-CLIP	23592263
MIRT460042	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT460040	hsa-miR-4537	PAR-CLIP	23592263
MIRT460039	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT460038	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT460037	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT460036	hsa-miR-6134	PAR-CLIP	23592263
MIRT460035	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT460034	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT460033	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT460032	hsa-miR-3612	PAR-CLIP	23592263
MIRT460031	hsa-miR-650	PAR-CLIP	23592263
MIRT460030	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT460029	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT460028	hsa-miR-8085	PAR-CLIP	23592263
MIRT460027	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT460026	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT460025	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT460024	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT460023	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT460022	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT460021	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT447196	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT447195	hsa-miR-3607-5p	PAR-CLIP	22100165
MIRT447194	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT447193	hsa-miR-4659a-5p	PAR-CLIP	22100165
MIRT447192	hsa-miR-4659b-5p	PAR-CLIP	22100165
MIRT447196	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT447195	hsa-miR-3607-5p	PAR-CLIP	22100165
MIRT447194	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT447193	hsa-miR-4659a-5p	PAR-CLIP	22100165
MIRT447192	hsa-miR-4659b-5p	PAR-CLIP	22100165
MIRT440969	hsa-miR-409-3p	HITS-CLIP	24374217
MIRT440969	hsa-miR-409-3p	HITS-CLIP	24374217
MIRT564109	hsa-miR-1225-3p	PAR-CLIP	26701625
MIRT460027	hsa-miR-1233-5p	PAR-CLIP	26701625
MIRT564105	hsa-miR-1273e	PAR-CLIP	26701625
MIRT564107	hsa-miR-1827	PAR-CLIP	26701625
MIRT460049	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT460049	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT460049	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT460049	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT460049	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT460049	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT460042	hsa-miR-219b-3p	PAR-CLIP	26701625
MIRT460035	hsa-miR-2467-3p	PAR-CLIP	26701625
MIRT460051	hsa-miR-302f	PAR-CLIP	26701625
MIRT460024	hsa-miR-30c-1-3p	PAR-CLIP	26701625
MIRT460023	hsa-miR-30c-2-3p	PAR-CLIP	26701625
MIRT460032	hsa-miR-3612	PAR-CLIP	26701625
MIRT460047	hsa-miR-3929	PAR-CLIP	26701625
MIRT460044	hsa-miR-4257	PAR-CLIP	26701625
MIRT460046	hsa-miR-4419b	PAR-CLIP	26701625
MIRT564111	hsa-miR-4459	PAR-CLIP	26701625
MIRT460045	hsa-miR-4478	PAR-CLIP	26701625
MIRT460040	hsa-miR-4537	PAR-CLIP	26701625
MIRT460025	hsa-miR-455-3p	PAR-CLIP	26701625
MIRT460050	hsa-miR-4695-5p	PAR-CLIP	26701625
MIRT460039	hsa-miR-485-5p	PAR-CLIP	26701625
MIRT460036	hsa-miR-6134	PAR-CLIP	26701625
MIRT460034	hsa-miR-6499-3p	PAR-CLIP	26701625
MIRT460031	hsa-miR-650	PAR-CLIP	26701625
MIRT460048	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT460048	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT460048	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT460048	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT460048	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT460048	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT460021	hsa-miR-6516-5p	PAR-CLIP	26701625
MIRT460043	hsa-miR-665	PAR-CLIP	26701625
MIRT460029	hsa-miR-6731-5p	PAR-CLIP	26701625
MIRT460026	hsa-miR-6778-5p	PAR-CLIP	26701625
MIRT460022	hsa-miR-6788-5p	PAR-CLIP	26701625
MIRT564106	hsa-miR-6807-5p	PAR-CLIP	26701625
MIRT564110	hsa-miR-6840-3p	PAR-CLIP	26701625
MIRT460030	hsa-miR-6878-5p	PAR-CLIP	26701625
MIRT460038	hsa-miR-6884-5p	PAR-CLIP	26701625
MIRT460033	hsa-miR-7160-5p	PAR-CLIP	26701625
MIRT460041	hsa-miR-7162-3p	PAR-CLIP	26701625
MIRT460037	hsa-miR-7854-3p	PAR-CLIP	26701625
MIRT460028	hsa-miR-8085	PAR-CLIP	26701625
MIRT574126	hsa-miR-5196-3p	PAR-CLIP	20371350
MIRT574125	hsa-miR-4793-5p	PAR-CLIP	20371350
MIRT574124	hsa-miR-939-3p	PAR-CLIP	20371350
MIRT574122	hsa-miR-6852-5p	PAR-CLIP	20371350
MIRT574123	hsa-miR-6742-3p	PAR-CLIP	20371350
MIRT574121	hsa-miR-4667-5p	PAR-CLIP	20371350
MIRT574120	hsa-miR-4700-5p	PAR-CLIP	20371350
MIRT574119	hsa-miR-8089	PAR-CLIP	20371350
MIRT574118	hsa-miR-4693-3p	PAR-CLIP	20371350
MIRT574117	hsa-miR-3144-5p	PAR-CLIP	20371350
MIRT574116	hsa-miR-3191-3p	PAR-CLIP	20371350
MIRT574115	hsa-miR-4652-5p	PAR-CLIP	20371350
MIRT574114	hsa-miR-1343-3p	PAR-CLIP	20371350
MIRT574113	hsa-miR-6783-3p	PAR-CLIP	20371350
MIRT574112	hsa-miR-6810-5p	PAR-CLIP	20371350
MIRT460051	hsa-miR-302f	PAR-CLIP	20371350
MIRT460050	hsa-miR-4695-5p	PAR-CLIP	20371350
MIRT460049	hsa-miR-1910-3p	PAR-CLIP	20371350
MIRT460048	hsa-miR-6511a-5p	PAR-CLIP	20371350
MIRT564111	hsa-miR-4459	PAR-CLIP	20371350
MIRT460043	hsa-miR-665	PAR-CLIP	20371350
MIRT564110	hsa-miR-6840-3p	PAR-CLIP	20371350
MIRT460042	hsa-miR-219b-3p	PAR-CLIP	20371350
MIRT564109	hsa-miR-1225-3p	PAR-CLIP	20371350
MIRT564108	hsa-miR-1233-3p	PAR-CLIP	20371350
MIRT564107	hsa-miR-1827	PAR-CLIP	20371350
MIRT460035	hsa-miR-2467-3p	PAR-CLIP	20371350
MIRT460032	hsa-miR-3612	PAR-CLIP	20371350
MIRT460031	hsa-miR-650	PAR-CLIP	20371350
MIRT460030	hsa-miR-6878-5p	PAR-CLIP	20371350
MIRT460029	hsa-miR-6731-5p	PAR-CLIP	20371350
MIRT460028	hsa-miR-8085	PAR-CLIP	20371350
MIRT460027	hsa-miR-1233-5p	PAR-CLIP	20371350
MIRT460026	hsa-miR-6778-5p	PAR-CLIP	20371350
MIRT564106	hsa-miR-6807-5p	PAR-CLIP	20371350
MIRT564105	hsa-miR-1273e	PAR-CLIP	20371350
MIRT460024	hsa-miR-30c-1-3p	PAR-CLIP	20371350
MIRT460023	hsa-miR-30c-2-3p	PAR-CLIP	20371350
MIRT460022	hsa-miR-6788-5p	PAR-CLIP	20371350
MIRT460051	hsa-miR-302f	PAR-CLIP	23592263
MIRT460050	hsa-miR-4695-5p	PAR-CLIP	23592263
MIRT460049	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT460048	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT460047	hsa-miR-3929	PAR-CLIP	23592263
MIRT460046	hsa-miR-4419b	PAR-CLIP	23592263
MIRT460045	hsa-miR-4478	PAR-CLIP	23592263
MIRT460044	hsa-miR-4257	PAR-CLIP	23592263
MIRT460043	hsa-miR-665	PAR-CLIP	23592263
MIRT460041	hsa-miR-7162-3p	PAR-CLIP	23592263
MIRT460042	hsa-miR-219b-3p	PAR-CLIP	23592263
MIRT460040	hsa-miR-4537	PAR-CLIP	23592263
MIRT460039	hsa-miR-485-5p	PAR-CLIP	23592263
MIRT460038	hsa-miR-6884-5p	PAR-CLIP	23592263
MIRT460037	hsa-miR-7854-3p	PAR-CLIP	23592263
MIRT460036	hsa-miR-6134	PAR-CLIP	23592263
MIRT460035	hsa-miR-2467-3p	PAR-CLIP	23592263
MIRT460034	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT460033	hsa-miR-7160-5p	PAR-CLIP	23592263
MIRT460032	hsa-miR-3612	PAR-CLIP	23592263
MIRT460031	hsa-miR-650	PAR-CLIP	23592263
MIRT460030	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT460029	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT460028	hsa-miR-8085	PAR-CLIP	23592263
MIRT460027	hsa-miR-1233-5p	PAR-CLIP	23592263
MIRT460026	hsa-miR-6778-5p	PAR-CLIP	23592263
MIRT460025	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT460024	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT460023	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT460022	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT460021	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT447196	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT447195	hsa-miR-3607-5p	PAR-CLIP	22100165
MIRT447194	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT447193	hsa-miR-4659a-5p	PAR-CLIP	22100165
MIRT447192	hsa-miR-4659b-5p	PAR-CLIP	22100165
MIRT447196	hsa-miR-100-3p	PAR-CLIP	22100165
MIRT447195	hsa-miR-3607-5p	PAR-CLIP	22100165
MIRT447194	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT447193	hsa-miR-4659a-5p	PAR-CLIP	22100165
MIRT447192	hsa-miR-4659b-5p	PAR-CLIP	22100165
MIRT879212	hsa-miR-1233	CLIP-seq
MIRT879213	hsa-miR-1255a	CLIP-seq
MIRT879214	hsa-miR-1255b	CLIP-seq
MIRT879215	hsa-miR-1285	CLIP-seq
MIRT879216	hsa-miR-142-3p	CLIP-seq
MIRT879217	hsa-miR-1587	CLIP-seq
MIRT879218	hsa-miR-2964a-3p	CLIP-seq
MIRT879219	hsa-miR-2964a-5p	CLIP-seq
MIRT879220	hsa-miR-296-5p	CLIP-seq
MIRT879221	hsa-miR-3127-3p	CLIP-seq
MIRT879222	hsa-miR-3135	CLIP-seq
MIRT879223	hsa-miR-3138	CLIP-seq
MIRT879224	hsa-miR-3187-5p	CLIP-seq
MIRT879225	hsa-miR-3605-5p	CLIP-seq
MIRT879226	hsa-miR-3616-5p	CLIP-seq
MIRT879227	hsa-miR-3647-5p	CLIP-seq
MIRT879228	hsa-miR-3661	CLIP-seq
MIRT879229	hsa-miR-3674	CLIP-seq
MIRT879230	hsa-miR-3914	CLIP-seq
MIRT879231	hsa-miR-4252	CLIP-seq
MIRT879232	hsa-miR-4265	CLIP-seq
MIRT879233	hsa-miR-4296	CLIP-seq
MIRT879234	hsa-miR-4299	CLIP-seq
MIRT879235	hsa-miR-4322	CLIP-seq
MIRT879236	hsa-miR-4417	CLIP-seq
MIRT879237	hsa-miR-4420	CLIP-seq
MIRT879238	hsa-miR-4492	CLIP-seq
MIRT879239	hsa-miR-4498	CLIP-seq
MIRT879240	hsa-miR-4504	CLIP-seq
MIRT879241	hsa-miR-4505	CLIP-seq
MIRT879242	hsa-miR-4649-3p	CLIP-seq
MIRT879243	hsa-miR-4656	CLIP-seq
MIRT879244	hsa-miR-4675	CLIP-seq
MIRT879245	hsa-miR-4684-5p	CLIP-seq
MIRT879246	hsa-miR-4741	CLIP-seq
MIRT879247	hsa-miR-4795-5p	CLIP-seq
MIRT879248	hsa-miR-4799-5p	CLIP-seq
MIRT879249	hsa-miR-513a-3p	CLIP-seq
MIRT879250	hsa-miR-562	CLIP-seq
MIRT879251	hsa-miR-573	CLIP-seq
MIRT879252	hsa-miR-580	CLIP-seq
MIRT879253	hsa-miR-612	CLIP-seq
MIRT879254	hsa-miR-631	CLIP-seq
MIRT879255	hsa-miR-648	CLIP-seq
MIRT879256	hsa-miR-762	CLIP-seq
MIRT879257	hsa-miR-766	CLIP-seq
MIRT879258	hsa-miR-873	CLIP-seq
MIRT879259	hsa-miR-933	CLIP-seq
MIRT879260	hsa-miR-1287	CLIP-seq
MIRT879261	hsa-miR-18a	CLIP-seq
MIRT879262	hsa-miR-18b	CLIP-seq
MIRT879263	hsa-miR-3135b	CLIP-seq
MIRT879264	hsa-miR-4735-3p	CLIP-seq
MIRT879265	hsa-miR-765	CLIP-seq
MIRT879231	hsa-miR-4252	CLIP-seq
MIRT879257	hsa-miR-766	CLIP-seq
MIRT1960629	hsa-miR-10a	CLIP-seq
MIRT1960630	hsa-miR-10b	CLIP-seq
MIRT879212	hsa-miR-1233	CLIP-seq
MIRT1960631	hsa-miR-1283	CLIP-seq
MIRT879215	hsa-miR-1285	CLIP-seq
MIRT1960632	hsa-miR-198	CLIP-seq
MIRT879218	hsa-miR-2964a-3p	CLIP-seq
MIRT1960633	hsa-miR-3133	CLIP-seq
MIRT879222	hsa-miR-3135	CLIP-seq
MIRT879224	hsa-miR-3187-5p	CLIP-seq
MIRT1960634	hsa-miR-339-5p	CLIP-seq
MIRT1960635	hsa-miR-3607-3p	CLIP-seq
MIRT1960636	hsa-miR-3646	CLIP-seq
MIRT1960637	hsa-miR-3673	CLIP-seq
MIRT1960638	hsa-miR-3686	CLIP-seq
MIRT879231	hsa-miR-4252	CLIP-seq
MIRT1960639	hsa-miR-4424	CLIP-seq
MIRT879245	hsa-miR-4684-5p	CLIP-seq
MIRT1960640	hsa-miR-4722-5p	CLIP-seq
MIRT1960641	hsa-miR-556-3p	CLIP-seq
MIRT1960642	hsa-miR-593	CLIP-seq
MIRT879253	hsa-miR-612	CLIP-seq
MIRT1960643	hsa-miR-661	CLIP-seq
MIRT879257	hsa-miR-766	CLIP-seq
MIRT879212	hsa-miR-1233	CLIP-seq
MIRT879215	hsa-miR-1285	CLIP-seq
MIRT2197308	hsa-miR-1298	CLIP-seq
MIRT2197309	hsa-miR-1909	CLIP-seq
MIRT2197310	hsa-miR-1972	CLIP-seq
MIRT2197311	hsa-miR-199a-3p	CLIP-seq
MIRT2197312	hsa-miR-199b-3p	CLIP-seq
MIRT2197313	hsa-miR-224	CLIP-seq
MIRT2197314	hsa-miR-2278	CLIP-seq
MIRT2197315	hsa-miR-2355-5p	CLIP-seq
MIRT879218	hsa-miR-2964a-3p	CLIP-seq
MIRT2197316	hsa-miR-3127-5p	CLIP-seq
MIRT2197317	hsa-miR-3129-5p	CLIP-seq
MIRT2197318	hsa-miR-3146	CLIP-seq
MIRT2197319	hsa-miR-3183	CLIP-seq
MIRT879224	hsa-miR-3187-5p	CLIP-seq
MIRT1960638	hsa-miR-3686	CLIP-seq
MIRT2197320	hsa-miR-383	CLIP-seq
MIRT2197321	hsa-miR-3915	CLIP-seq
MIRT2197322	hsa-miR-3928	CLIP-seq
MIRT879231	hsa-miR-4252	CLIP-seq
MIRT2197323	hsa-miR-4270	CLIP-seq
MIRT2197324	hsa-miR-4279	CLIP-seq
MIRT2197325	hsa-miR-4284	CLIP-seq
MIRT2197326	hsa-miR-4321	CLIP-seq
MIRT2197327	hsa-miR-4441	CLIP-seq
MIRT2197328	hsa-miR-4645-5p	CLIP-seq
MIRT2197329	hsa-miR-4650-5p	CLIP-seq
MIRT2197330	hsa-miR-4673	CLIP-seq
MIRT2197331	hsa-miR-4710	CLIP-seq
MIRT1960640	hsa-miR-4722-5p	CLIP-seq
MIRT2197332	hsa-miR-4723-3p	CLIP-seq
MIRT2197333	hsa-miR-4746-3p	CLIP-seq
MIRT2197334	hsa-miR-4757-5p	CLIP-seq
MIRT2197335	hsa-miR-4759	CLIP-seq
MIRT2197336	hsa-miR-4762-3p	CLIP-seq
MIRT2197337	hsa-miR-4772-3p	CLIP-seq
MIRT2197338	hsa-miR-510	CLIP-seq
MIRT2197339	hsa-miR-548p	CLIP-seq
MIRT879253	hsa-miR-612	CLIP-seq
MIRT2197340	hsa-miR-936	CLIP-seq
MIRT879212	hsa-miR-1233	CLIP-seq
MIRT879215	hsa-miR-1285	CLIP-seq
MIRT2197308	hsa-miR-1298	CLIP-seq
MIRT2197309	hsa-miR-1909	CLIP-seq
MIRT2197311	hsa-miR-199a-3p	CLIP-seq
MIRT2197312	hsa-miR-199b-3p	CLIP-seq
MIRT2197315	hsa-miR-2355-5p	CLIP-seq
MIRT2385836	hsa-miR-2682	CLIP-seq
MIRT879218	hsa-miR-2964a-3p	CLIP-seq
MIRT2197316	hsa-miR-3127-5p	CLIP-seq
MIRT2197317	hsa-miR-3129-5p	CLIP-seq
MIRT879222	hsa-miR-3135	CLIP-seq
MIRT879224	hsa-miR-3187-5p	CLIP-seq
MIRT1960637	hsa-miR-3673	CLIP-seq
MIRT2197320	hsa-miR-383	CLIP-seq
MIRT879231	hsa-miR-4252	CLIP-seq
MIRT2197323	hsa-miR-4270	CLIP-seq
MIRT2197327	hsa-miR-4441	CLIP-seq
MIRT2385837	hsa-miR-449c	CLIP-seq
MIRT2385838	hsa-miR-4536	CLIP-seq
MIRT2197335	hsa-miR-4759	CLIP-seq
MIRT2197336	hsa-miR-4762-3p	CLIP-seq
MIRT879253	hsa-miR-612	CLIP-seq
MIRT879257	hsa-miR-766	CLIP-seq
MIRT2197340	hsa-miR-936	CLIP-seq
MIRT1960629	hsa-miR-10a	CLIP-seq
MIRT1960630	hsa-miR-10b	CLIP-seq
MIRT879212	hsa-miR-1233	CLIP-seq
MIRT1960631	hsa-miR-1283	CLIP-seq
MIRT879218	hsa-miR-2964a-3p	CLIP-seq
MIRT1960634	hsa-miR-339-5p	CLIP-seq
MIRT1960635	hsa-miR-3607-3p	CLIP-seq
MIRT2446664	hsa-miR-3613-3p	CLIP-seq
MIRT1960638	hsa-miR-3686	CLIP-seq
MIRT879245	hsa-miR-4684-5p	CLIP-seq
MIRT1960640	hsa-miR-4722-5p	CLIP-seq
MIRT1960642	hsa-miR-593	CLIP-seq
MIRT1960629	hsa-miR-10a	CLIP-seq
MIRT1960630	hsa-miR-10b	CLIP-seq
MIRT879212	hsa-miR-1233	CLIP-seq
MIRT2500559	hsa-miR-1237	CLIP-seq
MIRT2500560	hsa-miR-1238	CLIP-seq
MIRT1960631	hsa-miR-1283	CLIP-seq
MIRT879215	hsa-miR-1285	CLIP-seq
MIRT2500561	hsa-miR-1303	CLIP-seq
MIRT2500562	hsa-miR-140-3p	CLIP-seq
MIRT2500563	hsa-miR-1910	CLIP-seq
MIRT2500564	hsa-miR-19a	CLIP-seq
MIRT2500565	hsa-miR-19b	CLIP-seq
MIRT2500566	hsa-miR-200b	CLIP-seq
MIRT2500567	hsa-miR-200c	CLIP-seq
MIRT2500568	hsa-miR-203	CLIP-seq
MIRT2500569	hsa-miR-204	CLIP-seq
MIRT2500570	hsa-miR-211	CLIP-seq
MIRT2500571	hsa-miR-2861	CLIP-seq
MIRT879218	hsa-miR-2964a-3p	CLIP-seq
MIRT879222	hsa-miR-3135	CLIP-seq
MIRT2500572	hsa-miR-3176	CLIP-seq
MIRT2500573	hsa-miR-3182	CLIP-seq
MIRT879224	hsa-miR-3187-5p	CLIP-seq
MIRT1960634	hsa-miR-339-5p	CLIP-seq
MIRT1960635	hsa-miR-3607-3p	CLIP-seq
MIRT2446664	hsa-miR-3613-3p	CLIP-seq
MIRT2500574	hsa-miR-3667-3p	CLIP-seq
MIRT1960638	hsa-miR-3686	CLIP-seq
MIRT2500575	hsa-miR-3922-3p	CLIP-seq
MIRT879231	hsa-miR-4252	CLIP-seq
MIRT2500576	hsa-miR-429	CLIP-seq
MIRT2500577	hsa-miR-4297	CLIP-seq
MIRT2500578	hsa-miR-4307	CLIP-seq
MIRT2500579	hsa-miR-4310	CLIP-seq
MIRT2500580	hsa-miR-4446-5p	CLIP-seq
MIRT879245	hsa-miR-4684-5p	CLIP-seq
MIRT1960640	hsa-miR-4722-5p	CLIP-seq
MIRT2500581	hsa-miR-4725-5p	CLIP-seq
MIRT2500582	hsa-miR-4755-5p	CLIP-seq
MIRT2500583	hsa-miR-4786-5p	CLIP-seq
MIRT2500584	hsa-miR-504	CLIP-seq
MIRT1960642	hsa-miR-593	CLIP-seq
MIRT879253	hsa-miR-612	CLIP-seq
MIRT2500585	hsa-miR-623	CLIP-seq
MIRT879257	hsa-miR-766	CLIP-seq
MIRT2500586	hsa-miR-769-5p	CLIP-seq
MIRT1960629	hsa-miR-10a	CLIP-seq
MIRT1960630	hsa-miR-10b	CLIP-seq
MIRT879212	hsa-miR-1233	CLIP-seq
MIRT1960631	hsa-miR-1283	CLIP-seq
MIRT879218	hsa-miR-2964a-3p	CLIP-seq
MIRT879222	hsa-miR-3135	CLIP-seq
MIRT1960634	hsa-miR-339-5p	CLIP-seq
MIRT1960635	hsa-miR-3607-3p	CLIP-seq
MIRT2446664	hsa-miR-3613-3p	CLIP-seq
MIRT1960638	hsa-miR-3686	CLIP-seq
MIRT879231	hsa-miR-4252	CLIP-seq
MIRT879245	hsa-miR-4684-5p	CLIP-seq
MIRT1960640	hsa-miR-4722-5p	CLIP-seq
MIRT1960642	hsa-miR-593	CLIP-seq
MIRT879257	hsa-miR-766	CLIP-seq

Show/Hide all (4)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21233420, 21725358, 25416956, 31980649, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
611735	24357	ENSG00000163814

Q9H5V8

Protein name

CUB domain-containing protein 1 (Membrane glycoprotein gp140) (Subtractive immunization M plus HEp3-associated 135 kDa protein) (SIMA135) (Transmembrane and associated with src kinases) (CD antigen CD318)

Protein function

May be involved in cell adhesion and cell matrix association. May play a role in the regulation of anchorage versus migration or proliferation versus differentiation via its phosphorylation. May be a novel marker for leukemia diagnosis and for i

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in mitotic cells with low expression during interphase. Detected at highest levels in skeletal muscle and colon with lower levels in kidney, small intestine, placenta and lung. Up-regulated in a number of human tumor c

Sequence

MAGLNCGVSIALLGVLLLGAARLPRGAEAFEIALPRESNITVLIKLGTPTLLAKPCYIVI
SKRHITMLSIKSGERIVFTFSCQSPENHFVIEIQKNIDCMSGPCPFGEVQLQPSTSLLPT
LNRTFIWDVKAHKSIGLELQFSIPRLRQIGPGESCPDGVTHSISGRIDATVVRIGTFCSN
GTVSRIKMQEGVKMALHLPWFHPRNVSGFSIANRSSIKRLCIIESVFEGEGSATLMSANY
PEGFPEDELMTWQFVVPAHLRASVSFLNFNLSNCERKEERVEYYIPGSTTNPEVFKLEDK
QPGNMAGNFNLSLQGCDQDAQSPGILRLQFQVLVQHPQNESNKIYVVDLSNERAMSLTIE
PRPVKQSRKFVPGCFVCLESRTCSSNLTLTSGSKHKISFLCDDLTRLWMNVEKTISCTDH
RYCQRKSYSLQVPSDILHLPVELHDFSWKLLVPKDRLSLVLVPAQKLQQHTHEKPCNTSF
SYLVASAIPSQDLYFGSFCPGGSIKQIQVKQNISVTLRTFAPSFQQEASRQGLTVSFIPY
FKEEGVFTVTPDTKSKVYLRTPNWDRGLPSLTSVSWNISVPRDQVACLTFFKERSGVVCQ
TGRAFMIIQEQRTRAEEIFSLDEDVLPKPSFHHHSFWVNISNCSPTSGKQLDLLFSVTLT
PRTVDLTVILIAAVGGGVLLLSALGLIICCVKKKKKKTNKGPAVGIYNDNINTEMPRQPK
KFQKGRKDNDSHVYAVIEDTMVYGHLLQDSSGSFLQPEVDTYRPFQGTMGVCPPSPPTIC
SRAPTAKLATEEPPPRSPPESESEPYTFSHPNNGDVSSKDTDIPLLNTQEPMEPAE

Sequence length

836

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoepithelial tumor	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOPATHY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (89)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	LHGDN	17785447, 19077003		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	20372833, 21233420, 31524271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	20372833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	37584418	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	40306441	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	28760953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28760953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	30796352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	15153610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16823897, 25728678, 25892239, 28454320, 29792166, 29973690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	23439492, 31843498, 35085554, 40391211	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19318475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	33574093	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	Pubtator	19318475	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	25301083, 26876198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	30796352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	11466621, 23510015, 25060522, 28429357, 28537886, 29433983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21617380	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	40019403	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18483744, 21233420, 22517515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	20372833		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	21617380, 27685922, 31278368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	36737481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	11466621, 25301083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11466621, 21618511, 25820997, 31461438, 31471585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17335815, 25301083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18483744, 21233420, 23378636		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	32983115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dry Eye Syndromes	Dry eye syndrome	Pubtator	39884388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	32983115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	21617380		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	24849519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	24849519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26956052	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33260155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	32983115	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	32983115	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Pancreatitis	Pubtator	25301083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	22369086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	22369086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29351434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29351434	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	31364124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15153610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31965270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	31965270, 34958004	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	21725358, 26553452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	21725358, 24939643, 25775948, 28429357, 33574093, 35643725	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	19077003	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16823897, 25728678, 25892239, 28454320, 29792166, 29973690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	24849519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	21233420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	11466621, 23510015, 25060522, 25775948, 28429357, 28537886, 29433983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	27685922, 31278368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	20501830, 24384474, 30396925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21233420, 29511352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	30796352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16823897, 19916495, 20372833, 20501830, 21812858, 22315226, 23378636, 23602898, 24384474, 24849519, 24939643, 25301083, 25728678, 25820997, 26882065 View all (4 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11466621, 25301083		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15153610, 25892239		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	21220330		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23439492	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	40617584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28760953, 29526637		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15153610, 21730355		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	22369086		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	22369086	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myopathy	Myopathy	GWASCAT_DG	31220337		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	17335815, 19916495, 20372833, 21233420, 22179830, 23378636, 24849519, 25892239, 25893298, 26882065, 27626701, 27685922, 29433983, 29511352, 29526637, 29792166 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	25893298		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	27685922, 31278368		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22315226, 27685922	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	20501830, 24384474, 30396925		★★★★★ ★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	39221259	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	39314522	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21233420, 29511352		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18483259		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21233420, 22390300, 26497208, 36880252	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29351434		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	21233420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18483744, 21233420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	LHGDN	18483744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	28760953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24849519		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26774363, 31151932	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26876198, 27626701, 28739932, 29792166, 29973690		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	26876198, 27626701, 29792166, 31843498	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33267838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	40617584	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CDCP1 (CUB domain containing protein 1)