Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	64863
Gene name	Methyltransferase 4, N6-adenosine
Gene symbol	METTL4
Synonyms (NCBI Gene)	HsT661
Chromosome	18
Chromosome location	18p11.32

175

Show/Hide all (175)

miRTarBase ID	miRNA	Experiments	Reference
MIRT048094	hsa-miR-197-3p	CLASH	23622248
MIRT1144659	hsa-miR-106a	CLIP-seq
MIRT1144660	hsa-miR-106b	CLIP-seq
MIRT1144661	hsa-miR-17	CLIP-seq
MIRT1144662	hsa-miR-1909	CLIP-seq
MIRT1144663	hsa-miR-208a	CLIP-seq
MIRT1144664	hsa-miR-208b	CLIP-seq
MIRT1144665	hsa-miR-20a	CLIP-seq
MIRT1144666	hsa-miR-20b	CLIP-seq
MIRT1144667	hsa-miR-302a	CLIP-seq
MIRT1144668	hsa-miR-302b	CLIP-seq
MIRT1144669	hsa-miR-302c	CLIP-seq
MIRT1144670	hsa-miR-302d	CLIP-seq
MIRT1144671	hsa-miR-302e	CLIP-seq
MIRT1144672	hsa-miR-3129-3p	CLIP-seq
MIRT1144673	hsa-miR-3136-5p	CLIP-seq
MIRT1144674	hsa-miR-3159	CLIP-seq
MIRT1144675	hsa-miR-3609	CLIP-seq
MIRT1144676	hsa-miR-3663-5p	CLIP-seq
MIRT1144677	hsa-miR-3667-5p	CLIP-seq
MIRT1144678	hsa-miR-371-5p	CLIP-seq
MIRT1144679	hsa-miR-371b-5p	CLIP-seq
MIRT1144680	hsa-miR-372	CLIP-seq
MIRT1144681	hsa-miR-373	CLIP-seq
MIRT1144682	hsa-miR-3915	CLIP-seq
MIRT1144683	hsa-miR-3925-3p	CLIP-seq
MIRT1144684	hsa-miR-3928	CLIP-seq
MIRT1144685	hsa-miR-3978	CLIP-seq
MIRT1144686	hsa-miR-4261	CLIP-seq
MIRT1144687	hsa-miR-4269	CLIP-seq
MIRT1144688	hsa-miR-4439	CLIP-seq
MIRT1144689	hsa-miR-4450	CLIP-seq
MIRT1144690	hsa-miR-4475	CLIP-seq
MIRT1144691	hsa-miR-4496	CLIP-seq
MIRT1144692	hsa-miR-4645-5p	CLIP-seq
MIRT1144693	hsa-miR-4668-5p	CLIP-seq
MIRT1144694	hsa-miR-4673	CLIP-seq
MIRT1144695	hsa-miR-4710	CLIP-seq
MIRT1144696	hsa-miR-4755-3p	CLIP-seq
MIRT1144697	hsa-miR-4786-3p	CLIP-seq
MIRT1144698	hsa-miR-4792	CLIP-seq
MIRT1144699	hsa-miR-4796-3p	CLIP-seq
MIRT1144700	hsa-miR-4803	CLIP-seq
MIRT1144701	hsa-miR-499-5p	CLIP-seq
MIRT1144702	hsa-miR-513c	CLIP-seq
MIRT1144703	hsa-miR-514b-5p	CLIP-seq
MIRT1144704	hsa-miR-515-5p	CLIP-seq
MIRT1144705	hsa-miR-519d	CLIP-seq
MIRT1144706	hsa-miR-520a-3p	CLIP-seq
MIRT1144707	hsa-miR-520b	CLIP-seq
MIRT1144708	hsa-miR-520c-3p	CLIP-seq
MIRT1144709	hsa-miR-520d-3p	CLIP-seq
MIRT1144710	hsa-miR-520e	CLIP-seq
MIRT1144711	hsa-miR-520f	CLIP-seq
MIRT1144712	hsa-miR-548aa	CLIP-seq
MIRT1144713	hsa-miR-548ah	CLIP-seq
MIRT1144714	hsa-miR-548t	CLIP-seq
MIRT1144715	hsa-miR-636	CLIP-seq
MIRT1144716	hsa-miR-766	CLIP-seq
MIRT1144717	hsa-miR-922	CLIP-seq
MIRT1144718	hsa-miR-93	CLIP-seq
MIRT1144719	hsa-miR-943	CLIP-seq
MIRT2041174	hsa-miR-3117-5p	CLIP-seq
MIRT1144672	hsa-miR-3129-3p	CLIP-seq
MIRT1144678	hsa-miR-371-5p	CLIP-seq
MIRT1144679	hsa-miR-371b-5p	CLIP-seq
MIRT2041175	hsa-miR-4698	CLIP-seq
MIRT1144702	hsa-miR-513c	CLIP-seq
MIRT1144703	hsa-miR-514b-5p	CLIP-seq
MIRT1144717	hsa-miR-922	CLIP-seq
MIRT2454024	hsa-miR-4659a-3p	CLIP-seq
MIRT2454025	hsa-miR-4659b-3p	CLIP-seq
MIRT2454026	hsa-miR-4777-5p	CLIP-seq
MIRT2454027	hsa-miR-518d-5p	CLIP-seq
MIRT2454028	hsa-miR-519b-5p	CLIP-seq
MIRT2454029	hsa-miR-519c-5p	CLIP-seq
MIRT2454030	hsa-miR-520c-5p	CLIP-seq
MIRT2454031	hsa-miR-526a	CLIP-seq
MIRT2454032	hsa-miR-579	CLIP-seq
MIRT2569845	hsa-miR-103a	CLIP-seq
MIRT2569846	hsa-miR-107	CLIP-seq
MIRT2569847	hsa-miR-1236	CLIP-seq
MIRT2569848	hsa-miR-133a	CLIP-seq
MIRT2569849	hsa-miR-133b	CLIP-seq
MIRT2569850	hsa-miR-15a	CLIP-seq
MIRT2569851	hsa-miR-15b	CLIP-seq
MIRT2569852	hsa-miR-16	CLIP-seq
MIRT2569853	hsa-miR-182	CLIP-seq
MIRT2569854	hsa-miR-185	CLIP-seq
MIRT2569855	hsa-miR-195	CLIP-seq
MIRT2569856	hsa-miR-2113	CLIP-seq
MIRT2569857	hsa-miR-31	CLIP-seq
MIRT2569858	hsa-miR-3133	CLIP-seq
MIRT2569859	hsa-miR-3144-3p	CLIP-seq
MIRT2569860	hsa-miR-3158-5p	CLIP-seq
MIRT2569861	hsa-miR-3166	CLIP-seq
MIRT2569862	hsa-miR-34a	CLIP-seq
MIRT2569863	hsa-miR-34c-5p	CLIP-seq
MIRT2569864	hsa-miR-3611	CLIP-seq
MIRT2569865	hsa-miR-3613-3p	CLIP-seq
MIRT2569866	hsa-miR-3647-3p	CLIP-seq
MIRT2569867	hsa-miR-3688-5p	CLIP-seq
MIRT2569868	hsa-miR-377	CLIP-seq
MIRT2569869	hsa-miR-424	CLIP-seq
MIRT2569870	hsa-miR-4306	CLIP-seq
MIRT2569871	hsa-miR-4318	CLIP-seq
MIRT2569872	hsa-miR-4434	CLIP-seq
MIRT2569873	hsa-miR-4457	CLIP-seq
MIRT2569874	hsa-miR-4468	CLIP-seq
MIRT2569875	hsa-miR-4470	CLIP-seq
MIRT2569876	hsa-miR-4494	CLIP-seq
MIRT2569877	hsa-miR-4499	CLIP-seq
MIRT2569878	hsa-miR-449a	CLIP-seq
MIRT2569879	hsa-miR-449b	CLIP-seq
MIRT2569880	hsa-miR-4502	CLIP-seq
MIRT2569881	hsa-miR-4516	CLIP-seq
MIRT2569882	hsa-miR-4531	CLIP-seq
MIRT2569883	hsa-miR-4644	CLIP-seq
MIRT2569884	hsa-miR-4676-5p	CLIP-seq
MIRT2569885	hsa-miR-4693-5p	CLIP-seq
MIRT1144696	hsa-miR-4755-3p	CLIP-seq
MIRT2569886	hsa-miR-4757-5p	CLIP-seq
MIRT2569887	hsa-miR-4771	CLIP-seq
MIRT2569888	hsa-miR-4777-3p	CLIP-seq
MIRT1144699	hsa-miR-4796-3p	CLIP-seq
MIRT1144700	hsa-miR-4803	CLIP-seq
MIRT2569889	hsa-miR-495	CLIP-seq
MIRT2569890	hsa-miR-497	CLIP-seq
MIRT2569891	hsa-miR-514	CLIP-seq
MIRT2569892	hsa-miR-514b-3p	CLIP-seq
MIRT2569893	hsa-miR-520g	CLIP-seq
MIRT2569894	hsa-miR-520h	CLIP-seq
MIRT2569895	hsa-miR-575	CLIP-seq
MIRT2569896	hsa-miR-603	CLIP-seq
MIRT2569897	hsa-miR-758	CLIP-seq
MIRT2569898	hsa-miR-875-5p	CLIP-seq
MIRT2569899	hsa-miR-888	CLIP-seq
MIRT2569900	hsa-miR-892a	CLIP-seq
MIRT2569845	hsa-miR-103a	CLIP-seq
MIRT2569846	hsa-miR-107	CLIP-seq
MIRT2569847	hsa-miR-1236	CLIP-seq
MIRT2569848	hsa-miR-133a	CLIP-seq
MIRT2569849	hsa-miR-133b	CLIP-seq
MIRT2569850	hsa-miR-15a	CLIP-seq
MIRT2569851	hsa-miR-15b	CLIP-seq
MIRT2569852	hsa-miR-16	CLIP-seq
MIRT2569854	hsa-miR-185	CLIP-seq
MIRT2569855	hsa-miR-195	CLIP-seq
MIRT2569858	hsa-miR-3133	CLIP-seq
MIRT2569860	hsa-miR-3158-5p	CLIP-seq
MIRT2569861	hsa-miR-3166	CLIP-seq
MIRT2569862	hsa-miR-34a	CLIP-seq
MIRT2569863	hsa-miR-34c-5p	CLIP-seq
MIRT2569867	hsa-miR-3688-5p	CLIP-seq
MIRT2569869	hsa-miR-424	CLIP-seq
MIRT2569870	hsa-miR-4306	CLIP-seq
MIRT2569871	hsa-miR-4318	CLIP-seq
MIRT2569873	hsa-miR-4457	CLIP-seq
MIRT2569874	hsa-miR-4468	CLIP-seq
MIRT2569875	hsa-miR-4470	CLIP-seq
MIRT2569876	hsa-miR-4494	CLIP-seq
MIRT2569877	hsa-miR-4499	CLIP-seq
MIRT2569878	hsa-miR-449a	CLIP-seq
MIRT2569879	hsa-miR-449b	CLIP-seq
MIRT2569883	hsa-miR-4644	CLIP-seq
MIRT2569884	hsa-miR-4676-5p	CLIP-seq
MIRT2569885	hsa-miR-4693-5p	CLIP-seq
MIRT1144696	hsa-miR-4755-3p	CLIP-seq
MIRT2569887	hsa-miR-4771	CLIP-seq
MIRT1144699	hsa-miR-4796-3p	CLIP-seq
MIRT2569890	hsa-miR-497	CLIP-seq
MIRT2569893	hsa-miR-520g	CLIP-seq
MIRT2569894	hsa-miR-520h	CLIP-seq
MIRT2569895	hsa-miR-575	CLIP-seq
MIRT2569900	hsa-miR-892a	CLIP-seq

Show/Hide all (30)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0005634	Component	Nucleus	IDA	31913360, 32183942
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IDA	32183942
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA	32183942
GO:0005829	Component	Cytosol	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0008168	Function	Methyltransferase activity	IEA
GO:0008173	Function	RNA methyltransferase activity	IBA
GO:0008173	Function	RNA methyltransferase activity	IDA	31913360
GO:0008757	Function	S-adenosylmethionine-dependent methyltransferase activity	IEA
GO:0009007	Function	Site-specific DNA-methyltransferase (adenine-specific) activity	IBA
GO:0009007	Function	Site-specific DNA-methyltransferase (adenine-specific) activity	IDA	32183942
GO:0009007	Function	Site-specific DNA-methyltransferase (adenine-specific) activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0032259	Process	Methylation	IEA
GO:0036396	Component	RNA N6-methyladenosine methyltransferase complex	IEA
GO:0036396	Component	RNA N6-methyladenosine methyltransferase complex	IMP	36354136
GO:0043484	Process	Regulation of RNA splicing	IMP	31913360
GO:0045814	Process	Negative regulation of gene expression, epigenetic	ISS
GO:0090296	Process	Regulation of mitochondrial DNA replication	IMP	32183942
GO:0106347	Function	U2 snRNA 2'-O-methyladenosine m6 methyltransferase activity	IEA
GO:0120049	Process	SnRNA (adenine-N6)-methylation	IDA	31913360
GO:0140640	Function	Catalytic activity, acting on a nucleic acid	IEA
GO:1903108	Process	Regulation of mitochondrial transcription	IMP	32183942
GO:1990204	Component	Oxidoreductase complex	IMP	36354136

MIM	HGNC	e!Ensembl
619626	24726	ENSG00000101574

Q8N3J2

Protein name

N(6)-adenine-specific methyltransferase METTL4 (Methyltransferase-like protein 4) (N(6)-adenine-specific DNA methyltransferase METTL4) (EC 2.1.1.72) (snRNA (2'-O-methyladenosine-N(6)-)-methyltransferase METTL4) (EC 2.1.1.-)

Protein function

N(6)-adenine-specific methyltransferase that can methylate both RNAs and DNA (PubMed:31913360, PubMed:32183942). Acts as a N(6)-adenine-specific RNA methyltransferase by catalyzing formation of N6,2'-O-dimethyladenosine (m6A(m)) on internal posi

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF05063	MT-A70	281 → 455	MT-A70	Family

Sequence

MSVVHQLSAGWLLDHLSFINKINYQLHQHHEPCCRKKEFTTSVHFESLQMDSVSSSGVCA
AFIASDSSTKPENDDGGNYEMFTRKFVFRPELFDVTKPYITPAVHKECQQSNEKEDLMNG
VKKEISISIIGKKRKRCVVFNQGELDAMEYHTKIRELILDGSLQLIQEGLKSGFLYPLFE
KQDKGSKPITLPLDACSLSELCEMAKHLPSLNEMEHQTLQLVEEDTSVTEQDLFLRVVEN
NSSFTKVITLMGQKYLLPPKSSFLLSDISCMQPLLNYRKTFDVIVIDPPWQNKSVKRSNR
YSYLSPLQIQQIPIPKLAAPNCLLVTWVTNRQKHLRFIKEELYPSWSVEVVAEWHWVKIT
NSGEFVFPLDSPHKKPYEGLILGRVQEKTALPLRNADVNVLPIPDHKLIVSVPCTLHSHK
PPLAEVLKDYIKPDGEYLELFARNLQPGWTSWGNEVLKFQHVDYFIAVESGS

Sequence length

472

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Clear cell carcinoma of kidney	Likely pathogenic	rs148311311	RCV005930401	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (15)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHILDHOOD ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC OBSTRUCTIVE PULMONARY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (8)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Colonic Neoplasms	Colonic neoplasm	Pubtator	31823961	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of face	Facial dysmorphism	BEFREE	30982744		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	37061119	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	34452636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	31217906		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	31823961		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paresthesia	Paresthesia	Pubtator	23834954	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	35177638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

METTL4 (methyltransferase 4, N6-adenosine)